Diaphorina citri psyllid: psy14047

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350

MEATERPIIGILTQEPCLGVDKHFADFKSYIPASYVKAVEASGARVAPIFIGNPEAYYRKILGQVNGVLIPGGGASFYADDGYAKAGAMIYKIAKEVSYRELDIWQSLLKIEKILGQVNGVLIPGGGASFYADDGYAKAGAMIYKIAKEFNENRDYFPIMGICLGFQLLLYTSNNENELRTRCDCFYENLALEFMPSFRQSLLYSRAPIHVLQELATSHITHNWHMWCITPSNFTDNGLAKEWKVLSTNSNNRGLKFISSVEHKVYPFAGIQFHPEKNAYEWKLTQDNPHTRIAIENARYFFDWLVSQASGSHHSFETEEEEKAALIYNYCPEYTAYIPGIGYDQTYLFK

cccccccEEEEEccccccccccccccccCEEEHHHHHHHHHcccEEEcccccccHHHHHHHHccccEEEEccccccccccccccccccEEEHHHHHcccEEEEccccHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHccccCCccccccccccccEEEccccccccccccccHHHHHHHccccCEEEEccEEEEEccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEECccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccCEEECccccccEEEEEEcc

**ATERPIIGILTQEPCLGVDKHFADFKSYIPASYVKAVEASGARVAPIFIGNPEAYYRKILGQVNGVLIPGGGASFYADDGYAKAGAMIYKIAKEVSYRELDIWQSLLKIEKILGQVNGVLIPGGGASFYADDGYAKAGAMIYKIAKEFNENRDYFPIMGICLGFQLLLYTSNNENELRTRCDCFYENLALEFMPSFRQSLLYSRAPIHVLQELATSHITHNWHMWCITPSNFTDNGLAKEWKVLSTNSNNRGLKFISSVEHKVYPFAGIQFHPEKNAYEWKLTQDNPHTRIAIENARYFFDWLVSQASGSHH*****EEEKAALIYNYCPEYTAYIPGIGYDQTYLFK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Gamma-glutamyl hydrolase	Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Exhibits either endo- or exopeptidase activity depending upon the tissue of origin. When secreted, it acts primarily as an endopeptidase.	confident	Q62867
Gamma-glutamyl hydrolase	Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates.	confident	Q92820
Gamma-glutamyl hydrolase	Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates. Acts as endopeptidase. Lysosomal enzyme is activated by sulfhydryl compounds.	confident	Q9Z0L8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046900 [BP]	tetrahydrofolylpolyglutamate metabolic process	probable	GO:0006732, GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0051186, GO:0006520, GO:0042558, GO:0071704, GO:1901605, GO:0006760, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237, GO:0043170
GO:0005773 [CC]	vacuole	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0010043 [BP]	response to zinc ion	probable	GO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0034722 [MF]	gamma-glutamyl-peptidase activity	probable	GO:0016787, GO:0003824, GO:0008242, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0032868 [BP]	response to insulin stimulus	probable	GO:1901700, GO:0009719, GO:0050896, GO:0009725, GO:0010243, GO:1901698, GO:0008150, GO:1901652, GO:0042221, GO:0043434, GO:0010033
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0005618 [CC]	cell wall	probable	GO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0045471 [BP]	response to ethanol	probable	GO:1901700, GO:0050896, GO:0008150, GO:0042221, GO:0097305, GO:0010033

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.4.-.-	Acting on peptide bonds (peptide hydrolases).	probable
3.4.19.-	Omega peptidases.	probable
3.4.19.9	Transferred entry: 3.4.19.9.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L9X, chain A
Confidence level:very confident
Coverage over the Query: 4-80,98-101,136-350
View the alignment between query and template
View the model in PyMOL

Template: 3FIJ, chain A
Confidence level:very confident
Coverage over the Query: 5-13,32-90,127-282,296-312
View the alignment between query and template
View the model in PyMOL

Template: 3EN0, chain A
Confidence level:probable
Coverage over the Query: 109-171
View the alignment between query and template
View the model in PyMOL