Diaphorina citri psyllid: psy14060


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
DLEAAKKEPELQPWQKKNILKSRTASSDRSGVSTEETKIIDGRKVSVPEPSASGVHGKEIHTAKSQQVQKEKKGDKEIVRKITATETTEMEHKGKIQERVVDASELDDDGYYAITERKYYALSDLSEQKPAKPPVFTKKIQPCRAFEQDQARFEVEFDGDPLPTIKWFREDFPITSSPDFQIHTFSTKSILIMRQVFMEDSGVFAVIAENRGGKAKCSANLVVEEKRQGGRGGVVPPSFLTTISSAVINVGQLARFDAKISATKPLDVYWLKVSSLSDVKRGV
cccccccccccccccccCEEcccccccCCcCEEccccCEEEEECccccccCEEEECccCEEEcccccEEEEEccccEEEEEEcccccEEEEEEccEEEEEEccccccccCEEEEEEEEccCEEECcccccccccEEEEccccEEEEccccEEEEEEEEcccccEEEEEEccEEccccccEEEEEcccEEEEEEccccccccEEEEEEEEEcccCEEEEEEEEEEEccccccccccccEEEEEcccEEEcccccEEEEEEEEECcccEEEEEEccEECcccccc
***********************************ETKIIDGRKVSVPEPSASGVHGKEIHTAKSQQVQKEKKGDKEIVRKITATETTEMEHKGKIQERVVDASELDDDGYYAITERKYYALSD******AKPPVFTKKIQPCRAFEQDQARFEVEFDGDPLPTIKWFREDFPITSSPDFQIHTFSTKSILIMRQVFMEDSGVFAVIAENRGGKAKCSANLVVEEKRQGGRGGVVPPSFLTTISSAVINVGQLARFDAKISATKPLDVYWLKVSS********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DLEAAKKEPELQPWQKKNILKSRTASSDRSGVSTEETKIIDGRKVSVPEPSASGVHGKEIHTAKSQQVQKEKKGDKEIVRKITATETTEMEHKGKIQERVVDASELDDDGYYAITERKYYALSDLSEQKPAKPPVFTKKIQPCRAFEQDQARFEVEFDGDPLPTIKWFREDFPITSSPDFQIHTFSTKSILIMRQVFMEDSGVFAVIAENRGGKAKCSANLVVEEKRQGGRGGVVPPSFLTTISSAVINVGQLARFDAKISATKPLDVYWLKVSSLSDVKRGV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Titin Key component in the assembly and functioning of adult and embryonic striated muscles and muscle tendons. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.confidentQ9I7U4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000794 [CC]condensed nuclear chromosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0007520 [BP]myoblast fusionprobableGO:0030154, GO:0061061, GO:0014706, GO:0000768, GO:0006949, GO:0009653, GO:0007275, GO:0044699, GO:0007517, GO:0051146, GO:0007519, GO:0048513, GO:0048869, GO:0035914, GO:0048646, GO:0032502, GO:0032501, GO:0014902, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0007498 [BP]mesoderm developmentprobableGO:0032502, GO:0048856, GO:0008150, GO:0009888
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0016203 [BP]muscle attachmentprobableGO:0032502, GO:0007517, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0061061, GO:0048513, GO:0008150, GO:0060538, GO:0048731, GO:0007275, GO:0044699
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0035206 [BP]regulation of hemocyte proliferationprobableGO:0042127, GO:0050793, GO:0050794, GO:0008150, GO:0002682, GO:0051239, GO:0065007, GO:0050789
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0043621 [MF]protein self-associationprobableGO:0003674, GO:0005488, GO:0005515
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0007076 [BP]mitotic chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0022402, GO:0016043, GO:0007067, GO:0044699, GO:0006139, GO:0044260, GO:1901360, GO:0000280, GO:0006323, GO:0071704, GO:0071840, GO:0000278, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0007059, GO:0046483, GO:0006996, GO:0030261, GO:0007049, GO:0000070, GO:0000819, GO:0051276, GO:0044237, GO:0043170, GO:0048285, GO:0006259, GO:0044763
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051592 [BP]response to calcium ionprobableGO:0042221, GO:0050896, GO:0010035, GO:0008150, GO:0010038
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007062 [BP]sister chromatid cohesionprobableGO:0006996, GO:0051276, GO:0022402, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0044699, GO:0071840, GO:0007059, GO:0007049

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B43, chain A
Confidence level:very confident
Coverage over the Query: 20-225,236-280
View the alignment between query and template
View the model in PyMOL