Diaphorina citri psyllid: psy14077

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------

ARLNVDEEIFLVNPHGLLYNEITASSLVKVDMRGDIIEPVLGLWLSRVEALALAMVSCITRLQPRPWSKWICEETSSNLWVEANSDAEWVADGSPTHSSTPVKIDSALQFVPKNTNPKEFKKLQQQIKENRRADKITSGPQSQLLEGVSWEEAKKLQDANQSATGDQVILVGAASKELKSLAKKLQDANQSATGDQVILVGAASKGIIQRGFQHNATVYKTPYAKNPFDQMTDQEIEEYKSTVSRKQRGEFSYDDSESEALSSSAALPPRAGTKPPVSETDDESRDEADLMQDSLG

ccccccccEEEEcccccccccccccccEEEcccccCCcccccccccccHHcccHHHHHHHHHccccccEEEECccccccccccccccccccccccccccCEEEEccccccccccccHHHHHHHHHHHHHHHHccccccccccHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHcccc

*RLNVDEEIFLVNPHGLLYNEITASSLVKVDMRGDIIEPVLGLWLSRVEALALAMVSCITRLQPRPWSKWICEETSSNLWVEANSDAEWV******HSSTPVKIDSALQFVPKNTNPKEFKKLQQQIKENRRADKITSGPQSQLLEGVSWEEAKKLQ*************************************DQVILVGAASKGIIQRGFQHNATVYKTPYA************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

ARLNVDEEIFLVNPHGLLYNEITASSLVKVDMRGDIIEPVLGLWLSRVEALALAMVSCITRLQPRPWSKWICEETSSNLWVEANSDAEWVADGSPTHSSTPVKIDSALQFVPKNTNPKEFKKLQQQIKENRRADKITSGPQSQLLEGVSWEEAKKLQDANQSATGDQVILxxxxxxxxxxxxxxxxxxxxxATGDQVILVGAASKGIIQRGFQHNATVYKTPYAKNPFDQMTDQEIEEYKSTVSRKQRGEFSYDDSESEALSSSAALPPRAGTKPPVSETDDESRDEADLMQDSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein hu-li tai shao	Required for assembling actin at ring canals in developing egg chambers. Probably interacts with other developmental proteins involved in nurse cell/oocyte transport through the ring canals.	confident	Q02645

Prediction of Gene Ontology Terms

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OCR, chain A
Confidence level:very confident
Coverage over the Query: 1-179
View the alignment between query and template
View the model in PyMOL