Diaphorina citri psyllid: psy14089


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MLAANQNVEVENSDLSKSSIVYNNTHKGIATPNLQKTVVYCNKNEVVKQSFRIEIEVEEFTKKSKNASIASTAGSWYLETHSHQKPSRTQIFSRYTPGYHFSNMSSKNISTGEKLLSLIDDIELVAKKKQEAHNHLQKTVVYFNKNEVVKQSFRIEIEEFTKKSKNASTAGFEDAHGVWESASGSNKNEATAIFQAKQKLQSINKANKRPVSSEELIKYAHRISSSNAVCAPLTWQPGDPRRPYPTDIEMRVGFLGRLNDSPLNGHLLPQQSLGDLHRTPSELSQQNQFSWHSGDMHIGNVPLDRQQQNSNRESEDVEVMSTDSSSSSSSDSQ
ccccccccEEEccccccccEEEccccccccccccccEEEEEcccccccccEEEEEEEHHHHHcccccccccccccEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccc
************SDLSKSSIVYNNTHKGIATPNLQKTVVYCNKNEVVKQSFRIEIEVEEFT*******I*STAGSWYL************IFSRYTPGYHFSNM****ISTGEKLLSLIDDIELVAKKKQEAHNHLQKTVVYFNKNEVVKQSFRIEIEEF************EDAHGVWESASGSNKNEATAIFQAK*****************ELIKYAHRISSSNAVCAPLTWQPGDPRRPYPTDIEMRVGFLGRL***************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAANQNVEVENSDLSKSSIVYNNTHKGIATPNLQKTVVYCNKNEVVKQSFRIEIEVEEFTKKSKNASIASTAGSWYLETHSHQKPSRTQIFSRYTPGYHFSNMSSKNISTGEKLLSLIDDIELVAKKKQEAHNHLQKTVVYFNKNEVVKQSFRIEIEEFTKKSKNASTAGFEDAHGVWESASGSNKNEATAIFQAKQKLQSINKANKRPVSSEELIKYAHRISSSNAVCAPLTWQPGDPRRPYPTDIEMRVGFLGRLNDSPLNGHLLPQQSLGDLHRTPSELSQQNQFSWHSGDMHIGNVPLDRQQQNSNRESEDVEVMSTDSSSSSSSDSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 4 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for activated transcription of the MtnA, MtnB and MtnD genes.confidentQ9VS38
Mediator of RNA polymerase II transcription subunit 4 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.confidentQ9CQA5
Mediator of RNA polymerase II transcription subunit 4 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.confidentQ561Q8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016592 [CC]mediator complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0046966 [MF]thyroid hormone receptor bindingprobableGO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001104 [MF]RNA polymerase II transcription cofactor activityprobableGO:0001076, GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0004872 [MF]receptor activityprobableGO:0003674
GO:0030521 [BP]androgen receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PLT, chain A
Confidence level:probable
Coverage over the Query: 204-251
View the alignment between query and template
View the model in PyMOL
Template: 2PIH, chain A
Confidence level:probable
Coverage over the Query: 116-201
View the alignment between query and template
View the model in PyMOL