Diaphorina citri psyllid: psy1409

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MENLESLLEHLDISELKELVNDEETFNNFTKEATATLTTESNEQKEMLIASNKSLAEYNLSQEEALLEKKSQLLDLNEQLTQLSKSVESKVELIKSHKNNVSTDTVLALLQTAASEIEEESETTESNEQKEMLIASNKSLAEYNLSQEEALLEKKSQLLDLNEQLTQLSKSVESKVELIKSHKNNVSTDTVLALLQTAASEIEEESEKVPEEFLNGTIDVDKFLETFTPKRILMHLRRIKADKMAEMLTKRNSFGSPTHNGVGGHNGGSSSFGGMYPPVPVPPMGPGYPVSGGGMPLPHIQMTPYPQLPQMPTPSYPFYK
cccHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
******L*E**DISELKE*VND*ETFNNFTK***************MLIAS******************************************************VLALLQTAASEIEEESET*E*NEQKEMLIASNKSLAEYNLSQE*A*LE**SQLLDLNEQLTQLSK*******************TVLALLQ***************EFLNGTIDVDKFLETFTPKRILMHLRRIKA*******************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENLESLLEHLDISELKELVNDEETFNNFTKEATATLTTESNEQKEMLIASNKSLAEYNLSQEEAxxxxxxxxxxxxxxxxxxxxxVESKVELIKSHKNNVSTDTVxxxxxxxxxxxxxxxxxxxxxEQKEMLIASNKSLAEYNLSQEEAxxxxxxxxxxxxxxxxxxxxxVESKVELIKSHKNNVSTDTVLALLQTAASEIEEESEKVPEEFLNGTIDVDKFLETFTPKRILMHLRRIKADKMAEMLTKRNSFGSPTHNGVGGHNGGSSSFGGMYPPVPVPPMGPGYPVSGGGMPLPHIQMTPYPQLPQMPTPSYPFYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P22, chain C
Confidence level:confident
Coverage over the Query: 5-123,140-181
View the alignment between query and template
View the model in PyMOL
Template: 2P22, chain C
Confidence level:confident
Coverage over the Query: 97-247
View the alignment between query and template
View the model in PyMOL
Template: 3Q2S, chain C
Confidence level:probable
Coverage over the Query: 237-258
View the alignment between query and template
View the model in PyMOL