Diaphorina citri psyllid: psy140


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MVMVSPALNPVAVWEFEGEILVLHHPTTISSRYQAMVHCGSIRQTASILSMSAECLRTGDKAAVHFRFIKHPEYLRAGQRMVFREGRTKAVGNVTKVLPPSGHQGNYSHLSRTKANKMLSHRAQPNKTWALSPVTEKPEVKTPRDLDRAGQAGAKRGGVEGAEPSETKTRQPILEAGPISLLRP
cEEEcccccccCEEEEEEEEEEEEccccccccEEEEEEEcccEEEEEEEEccccccccccEEEEEEEEccccEEEccccEEEEEcccCEEEEEEEEECcccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MVMVS*ALNPVAVWEFEGEILVLHHPTTISSRYQAMVHCGSIRQTASILSMSAECLRTGDKAAVHFRFIKHPEYLRAGQRMVFREGRTKAVGNVTKVL******************************************************************************GPISLL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMVSPALNPVAVWEFEGEILVLHHPTTISSRYQAMVHCGSIRQTASILSMSAECLRTGDKAAVHFRFIKHPEYLRAGQRMVFREGRTKAVGNVTKVLPPSGHQGNYSHLSRTKANKMLSHRAQPNKTWALSPVTEKPEVKTPRDLDRAGQAGAKRGGVEGAEPSETKTRQPILEAGPISLLRP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GTP-binding protein 1 Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity.confidentD2XV59
GTP-binding protein 1 Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity.confidentO08582
GTP-binding protein 1 (Fragment) Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity.confidentQ5R8Q7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0061014 [BP]positive regulation of mRNA catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0031329, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0019219, GO:0065007, GO:0048518, GO:0045935, GO:0060255, GO:0031331, GO:0061013, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0019222, GO:0051252, GO:0051254, GO:0048522
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0000177 [CC]cytoplasmic exosome (RNase complex)probableGO:0005737, GO:0043234, GO:0000178, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JNY, chain A
Confidence level:very confident
Coverage over the Query: 1-99
View the alignment between query and template
View the model in PyMOL