Diaphorina citri psyllid: psy14113

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---

TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSNGSAKPGPVSPSGSSKDSNSPRASVATVPSPLYENVDYYNGRNAALTPPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNYQVSSPVDTTPSPSPSPKTPVTPYGKNLLPYNVTPPRPMGPTEAERKIEELTRQLEEEMEKQEEEGEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSPTDLQDV

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccCCcccccEEEcccccccccccccccccccccccccccccCEcccccccccccccHHHHHHHHccHHHHHccccccccccccccccHHHHcHHHHccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccECcccccccHHHHHHHcccccccccccccc

*************************************************************************************************************************************************************************************************************************************************************************************************************************EYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLS************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSNGSAKPGPVSPSGSSKDSNSPRASVATVPSPLYENVDYYNGRNAALTPPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNYQVSSPVDTTPSPSPSPKTPVTPYGKNLLPYNVTPPRPMGxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSPTDLQDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LIM domain-containing protein jub	Regulates organ size by inhibiting apoptosis and promoting cell proliferation by influencing the expression of G1/S-specific cyclin-E (CycE) and apoptosis 1 inhibitor (th). Negatively regulates the Hippo signaling pathway.	confident	Q9VY77
LIM domain-containing protein 1	Acts as a transcriptional corepressor for snai1 and snai2/slug and plays a role in regulating neural crest development.	confident	B7ZUL2
Wilms tumor protein 1-interacting protein homolog	May monitor slit diaphragm protein assembly, a specialized adherens junction characteristic of podocytes. In case of podocyte injury, it shuttles into the nucleus and acts as a transcription regulator. Plays a role in the regulation of cell morphology and cytoskeletal organization (By similarity). Acts as a transcriptional corepressor for snai1 and snai2/slug and plays a role in regulating neural crest development.	confident	A8DZE6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044422 [CC]	organelle part	probable	GO:0005575, GO:0043226
GO:0035195 [BP]	gene silencing by miRNA	probable	GO:0010605, GO:0019222, GO:0035194, GO:0010608, GO:0009987, GO:0040029, GO:0050789, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0044763, GO:0031047, GO:0010629, GO:0048519, GO:0016441, GO:0009892, GO:0010468, GO:0044699
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0000932 [CC]	cytoplasmic mRNA processing body	probable	GO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0035331 [BP]	negative regulation of hippo signaling cascade	probable	GO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0035330, GO:0050789, GO:0048523
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0044237 [BP]	cellular metabolic process	probable	GO:0009987, GO:0008150, GO:0008152
GO:0030054 [CC]	cell junction	probable	GO:0005575
GO:2000637 [BP]	positive regulation of gene silencing by miRNA	probable	GO:0050794, GO:0050789, GO:0060966, GO:0060147, GO:0060964, GO:0065007, GO:0048518, GO:0008150, GO:0060968, GO:0060148, GO:0048522
GO:0022604 [BP]	regulation of cell morphogenesis	probable	GO:0022603, GO:0050793, GO:0050794, GO:0065007, GO:0008150, GO:0051128, GO:0050789
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003714 [MF]	transcription corepressor activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0007010 [BP]	cytoskeleton organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RUT, chain X
Confidence level:very confident
Coverage over the Query: 315-383,403-463,480-498
View the alignment between query and template
View the model in PyMOL

Template: 1B8T, chain A
Confidence level:very confident
Coverage over the Query: 316-460
View the alignment between query and template
View the model in PyMOL

Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 403-533
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1twf, chain A		probable	Alignment \| Template Structure