Psyllid ID: psy14113

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSNGSAKPGPVSPSGSSKDSNSPRASVATVPSPLYENVDYYNGRNAALTPPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNYQVSSPVDTTPSPSPSPKTPVTPYGKNLLPYNVTPPRPMGPTEAERKIEELTRQLEEEMEKQEEEGEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSPTDLQDV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEcccccEEEcccccccccccccccccccccccccccccEEcccccccccccccHHHHHHHHccHHHHHccccccccccccccccHHHHcHHHHccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccEEcccccccHHHHHHHHccccccccccccc
cccccHHHHHccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEccccccccccccEEEEcccccccccEEEHHHHHHccccccEcccccEccHHHHHHHccccccccccccccHHHHHcccHHcccHHHHHcccHHHHHHHHHHccccccccEEEEEEcccccccEEEEEccccEEEHHHHHHHHccHccccccccccccccccEEEEEEcccccccccEEEEHccccccccccccEEccccccccHHcHHHHcccccccccccccc
tlhysekakyldakckpvgAIESFLvegtsrapapppvdykqyergniiasskfatpksvdnlpladvyrsngsakpgpvspsgsskdsnsprasvatvpsplyenvdyyngrnaaltppyyhqlphlrsgshssvgsqdskhssprgsyvsndinafqfdrkaqpqvpqglkyirdyppyeappvyeniqelnkppkpgpqvpvfggehRQMAialtsppvysrantvtskavpvktatslsvtpnyqvsspvdttpspspspktpvtpygknllpynvtpprpmgpteAERKIEELTRQLEEEMEKQEeegeyfgichtcgekvtgaGQACQAMgnlyhtncficcscgralrgkafynvhgrvyceedylysgfqqTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMgksyhpgcfrcclcnecldgvpftvdvdnkiycvndyhrmfapkcaacgkgitpvegteETVRVVSMDkdfhvdcymcedcglqltdepdkrcyplqgrlmcrachlshlsrhhqsptdlqdv
tlhysekakyldakckpVGAIESFlvegtsrapapppVDYKQYERGNIIasskfatpksvdnLPLADVYRSNgsakpgpvspsgsskdsnsprasvatvpsplYENVDYYNGRNAALTPPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFqfdrkaqpqvpQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTskavpvktatslsvtpnyqvsspvdttpspspspktpvtpygknllpynvTPPRPMGPTEAERKIEELTRQLEEEMEKQEEEGEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLShlsrhhqsptdlqdv
TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSNgsakpgpvspsgsskdsnspRASVATVPSPLYENVDYYNGRNAALTPPYYHQLPHLRsgshssvgsqdskhssPRGSYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNYQvsspvdttpspspspktpvtpYGKNLLPYNVTPPRPMGPTEAERKIeeltrqleeemekqeeegeYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSPTDLQDV
******************************************************************************************************LYENVDYYNGRNAALTPPYYHQL*********************************************GLKYIRDYPPYE***********************************************************************************************************************************EYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSH**************
*************************************************************************************************************************************************************************************************************************************************************************************************************************EYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLS************
TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSN*************************TVPSPLYENVDYYNGRNAALTPPYYHQLPHLR*******************SYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNY******************PVTPYGKNLLPYNVTPPRPMGPTEAERKIEELTRQ***********GEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLS***************
*****EKAKYLDAKCKPVGAIESFLVEGTS*****************IIASS*********************************************************************************************************************************************************************************************************************************************EAERKIEELTRQLEEEMEKQEEEGEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TLHYSEKAKYLDAKCKPVGAIESFLVEGTSRAPAPPPVDYKQYERGNIIASSKFATPKSVDNLPLADVYRSNGSAKPGPVSPSGSSKDSNSPRASVATVPSPLYENVDYYNGRNAALTPPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFQFDRKAQPQVPQGLKYIRDYPPYEAPPVYENIQELNKPPKPGPQVPVFGGEHRQMAIALTSPPVYSRANTVTSKAVPVKTATSLSVTPNYQVSSPVDTTPSPSPSPKTPVTPYGKNLLPYNVTPPRPMGxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRACHLSHLSRHHQSPTDLQDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query543 2.2.26 [Sep-21-2011]
Q9VY77728 LIM domain-containing pro yes N/A 0.546 0.407 0.719 1e-130
A9LS46690 Wilms tumor protein 1-int N/A N/A 0.443 0.349 0.646 3e-96
A8DZE6648 Wilms tumor protein 1-int yes N/A 0.429 0.359 0.662 2e-93
Q7TQJ8398 Wilms tumor protein 1-int yes N/A 0.418 0.570 0.630 1e-91
A6NIX2430 Wilms tumor protein 1-int yes N/A 0.515 0.651 0.557 1e-90
G5E5X0674 LIM domain-containing pro yes N/A 0.451 0.363 0.581 4e-90
B7ZUL2593 LIM domain-containing pro yes N/A 0.432 0.396 0.575 6e-90
B5DEH0663 LIM domain-containing pro no N/A 0.513 0.420 0.537 5e-89
Q9QXD8668 LIM domain-containing pro no N/A 0.688 0.559 0.443 8e-89
Q9UGP4676 LIM domain-containing pro no N/A 0.432 0.347 0.579 2e-87
>sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 Back     alignment and function desciption
 Score =  464 bits (1195), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/328 (71%), Positives = 260/328 (79%), Gaps = 31/328 (9%)

Query: 213 MAIALTSPPVYSRANTVTSKAVPVKTATS-LSVTPNYQVSSPVDTTPSPSPSPKT----- 266
           M +A  +PP  S A T  + A    T+T+ L  TP   +++P+    SP+PS  +     
Sbjct: 402 MGMATAAPPTTSNAPTSAAAAPAAPTSTASLRATP-IAMTAPLAVATSPTPSQGSTAVNA 460

Query: 267 ---PVTPYGKNLLPYNVTPPRPMGPTEAERKIEELTRQLEEEMEKQEEEGEYFGICHTCG 323
              P     KNLLPY+VTPPRP GPTEA+RKIEELTRQLEEE+E+ EE GEYFGICHTCG
Sbjct: 461 ALKPRRGLTKNLLPYSVTPPRPAGPTEAQRKIEELTRQLEEEIEQSEEHGEYFGICHTCG 520

Query: 324 EKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEK 383
           EKV GAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDY           
Sbjct: 521 EKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDY----------- 569

Query: 384 CAICGHLIMEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPF 443
                     MYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCC+CNECLDGVPF
Sbjct: 570 ----------MYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPF 619

Query: 444 TVDVDNKIYCVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGL 503
           TVDVD+KIYCVNDYHRMFAPKCA+CGKGITPVEGT+ETVRVVSMDKDFHVDCY+CE+CG+
Sbjct: 620 TVDVDHKIYCVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGM 679

Query: 504 QLTDEPDKRCYPLQGRLMCRACHLSHLS 531
           QLTDEPDKRCYPL GRL+CR CHL  L+
Sbjct: 680 QLTDEPDKRCYPLDGRLLCRGCHLQRLA 707
Regulates organ size by inhibiting apoptosis and promoting cell proliferation by influencing the expression of G1/S-specific cyclin-E (CycE) and apoptosis 1 inhibitor (th). Negatively regulates the Hippo signaling pathway.
Drosophila melanogaster (taxid: 7227)
>sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 Back     alignment and function description
>sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 Back     alignment and function description
>sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 Back     alignment and function description
>sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 Back     alignment and function description
>sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 Back     alignment and function description
>sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 Back     alignment and function description
>sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
193577853 676 PREDICTED: hypothetical protein LOC10016 0.810 0.650 0.564 1e-157
91081951594 PREDICTED: similar to limd1 [Tribolium c 0.830 0.759 0.548 1e-150
66522653 881 PREDICTED: hypothetical protein LOC40843 0.499 0.307 0.802 1e-130
320542048 723 ajuba LIM protein, isoform D [Drosophila 0.552 0.414 0.740 1e-130
195448589 656 GK10130 [Drosophila willistoni] gi|19416 0.541 0.448 0.703 1e-129
350426982 885 PREDICTED: hypothetical protein LOC10074 0.686 0.421 0.630 1e-129
380017484 882 PREDICTED: uncharacterized protein LOC10 0.493 0.303 0.804 1e-129
340723289 885 PREDICTED: hypothetical protein LOC10064 0.467 0.287 0.838 1e-129
320542046 718 ajuba LIM protein, isoform C [Drosophila 0.543 0.410 0.737 1e-129
195352482 718 GM17582 [Drosophila sechellia] gi|194126 0.543 0.410 0.737 1e-129
>gi|193577853|ref|XP_001951041.1| PREDICTED: hypothetical protein LOC100164991 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  562 bits (1448), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 313/554 (56%), Positives = 359/554 (64%), Gaps = 114/554 (20%)

Query: 70  RSNGSAKPGPVSP-----SGSSKDSNSPRASVATVP-----SPLYENVDYYNG-RNAALT 118
           RSN + KP   SP     S  ++DS SPRAS+ ++      SPLYENVD+YNG R++  T
Sbjct: 132 RSNMTLKPSLSSPPPYCTSIGNRDSPSPRASIGSISHELKSSPLYENVDFYNGGRSSTQT 191

Query: 119 PPYYHQLPHLRSGSHSSVGSQDSKHSSPRGSYVSNDINAFQFD---RKAQPQVPQGL-KY 174
           P YYHQ P  R GSHSS GSQDS+HSSPR S VS + ++  ++   RKAQPQVP    KY
Sbjct: 192 PTYYHQRP--RPGSHSSGGSQDSRHSSPRTSIVSCEGSSALYESTYRKAQPQVPVSYPKY 249

Query: 175 I----RDYPPYEAPPVYENIQELNK------PPKPGPQVPVFGGEHRQMAIALTSPPV-- 222
           I    ++ PPYEAPPVYE + + NK      P KPGPQVP    +H     A  + P   
Sbjct: 250 IPPMGKEVPPYEAPPVYETLSDTNKNSNCYEPAKPGPQVPTQSIDHISRYPAQHATPYIK 309

Query: 223 ---------------------------YSRANTVTSKAVPVKTATSLSVTPN-------- 247
                                      Y+ AN V+    PV T  S SV           
Sbjct: 310 PIPTIVPQAIKALSEYASQTNPQNMRSYNSANNVSYSQDPV-TPKSTSVASQMCVVGQPA 368

Query: 248 ----------------------YQVSSPVD----TTPSPSPSPKTPVTPYGKNLLPYNVT 281
                                 YQ  SP+     T  SP+P     +    KNLLPYNVT
Sbjct: 369 LAESRSQKQHNTMPKIFQTASAYQQESPIHQNKLTRTSPTPPLPIKIKQPAKNLLPYNVT 428

Query: 282 PPRPMGPTEAERKIEELTRQLEEEMEKQEEE--GEYFGICHTCGEKVTGAGQACQAMGNL 339
           PPRPMGPTEAE+KIEELTRQLEE+ME QE    GEYFGICHTCG KVTGAGQACQAMGNL
Sbjct: 429 PPRPMGPTEAEKKIEELTRQLEEQMETQEVAVGGEYFGICHTCGNKVTGAGQACQAMGNL 488

Query: 340 YHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMYSGFQ 399
           YHTNCFICC+CGRALRGKAFYNV+GRVYCEEDY                     MY GFQ
Sbjct: 489 YHTNCFICCACGRALRGKAFYNVYGRVYCEEDY---------------------MYIGFQ 527

Query: 400 QTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHR 459
           QTAEKC+ICGHLIMEMILQAMGKS+HPGCFRCC+CN CLDG+PFTVD+DNKIYCV DYHR
Sbjct: 528 QTAEKCSICGHLIMEMILQAMGKSFHPGCFRCCVCNGCLDGIPFTVDIDNKIYCVADYHR 587

Query: 460 MFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGR 519
            +APKCA+CGKGITPVEGTEETVRVVSMDKDFHVDC++CE+CG+QLTDEPDKRCYPL   
Sbjct: 588 KYAPKCASCGKGITPVEGTEETVRVVSMDKDFHVDCFICEECGMQLTDEPDKRCYPLDSH 647

Query: 520 LMCRACHLSHLSRH 533
           L+CR+CH+SHL+ +
Sbjct: 648 LLCRSCHISHLNEN 661

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91081951|ref|XP_967254.1| PREDICTED: similar to limd1 [Tribolium castaneum] gi|270007323|gb|EFA03771.1| hypothetical protein TcasGA2_TC013882 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|66522653|ref|XP_391978.2| PREDICTED: hypothetical protein LOC408431 [Apis mellifera] Back     alignment and taxonomy information
>gi|320542048|ref|NP_001188587.1| ajuba LIM protein, isoform D [Drosophila melanogaster] gi|318069372|gb|ADV37669.1| ajuba LIM protein, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195448589|ref|XP_002071725.1| GK10130 [Drosophila willistoni] gi|194167810|gb|EDW82711.1| GK10130 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|350426982|ref|XP_003494607.1| PREDICTED: hypothetical protein LOC100740563 [Bombus impatiens] Back     alignment and taxonomy information
>gi|380017484|ref|XP_003692685.1| PREDICTED: uncharacterized protein LOC100872641 isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|340723289|ref|XP_003400024.1| PREDICTED: hypothetical protein LOC100644496 [Bombus terrestris] Back     alignment and taxonomy information
>gi|320542046|ref|NP_001188586.1| ajuba LIM protein, isoform C [Drosophila melanogaster] gi|318069371|gb|ADV37668.1| ajuba LIM protein, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195352482|ref|XP_002042741.1| GM17582 [Drosophila sechellia] gi|194126772|gb|EDW48815.1| GM17582 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
FB|FBgn0030530728 jub "Ajuba LIM protein" [Droso 0.362 0.270 0.672 8.3e-88
UNIPROTKB|A9LS46690 wtip "Wilms tumor protein 1-in 0.355 0.279 0.561 5.4e-63
UNIPROTKB|A6NIX2430 WTIP "Wilms tumor protein 1-in 0.252 0.318 0.729 5.4e-61
UNIPROTKB|K7ENH9617 WTIP "Wilms tumor protein 1-in 0.252 0.222 0.729 5.4e-61
MGI|MGI:2141920398 Wtip "WT1-interacting protein" 0.338 0.462 0.573 2.4e-60
UNIPROTKB|F1NIC6189 WTIP "Uncharacterized protein" 0.254 0.730 0.731 3.1e-60
UNIPROTKB|E1BP33539 E1BP33 "Uncharacterized protei 0.335 0.337 0.574 8.1e-60
RGD|1306411321 Wtip "Wilms tumor 1 interactin 0.338 0.573 0.563 1e-59
ZFIN|ZDB-GENE-050419-261648 wtip "Wilms tumor 1 interactin 0.340 0.285 0.578 4.5e-59
UNIPROTKB|F1NK57232 LIMD1 "Uncharacterized protein 0.252 0.590 0.715 9.3e-59
FB|FBgn0030530 jub "Ajuba LIM protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 747 (268.0 bits), Expect = 8.3e-88, Sum P(4) = 8.3e-88
 Identities = 142/211 (67%), Positives = 159/211 (75%)

Query:   341 HTNCF-ICCSCGRALRGKA-FYNVHGRVYCEEDYLYSGFQQTAEKCA---ICGHLIME-- 393
             H   F IC +CG  ++G        G +Y    ++     +     A   + G +  E  
Sbjct:   509 HGEYFGICHTCGEKVKGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEED 568

Query:   394 -MYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIY 452
              MYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCC+CNECLDGVPFTVDVD+KIY
Sbjct:   569 YMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCVCNECLDGVPFTVDVDHKIY 628

Query:   453 CVNDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKR 512
             CVNDYHRMFAPKCA+CGKGITPVEGT+ETVRVVSMDKDFHVDCY+CE+CG+QLTDEPDKR
Sbjct:   629 CVNDYHRMFAPKCASCGKGITPVEGTDETVRVVSMDKDFHVDCYICEECGMQLTDEPDKR 688

Query:   513 CYPLQGRLMCRACHLSHL----SRH--HQSP 537
             CYPL GRL+CR CHL  L    S H  HQ P
Sbjct:   689 CYPLDGRLLCRGCHLQRLALQSSPHARHQEP 719
GO:0016922 "ligand-dependent nuclear receptor binding" evidence=ISS
GO:0046966 "thyroid hormone receptor binding" evidence=ISS
GO:0003779 "actin binding" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005912 "adherens junction" evidence=IDA
GO:0046622 "positive regulation of organ growth" evidence=IMP
GO:0035329 "hippo signaling cascade" evidence=IMP
GO:0045572 "positive regulation of imaginal disc growth" evidence=IMP
UNIPROTKB|A9LS46 wtip "Wilms tumor protein 1-interacting protein homolog" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|A6NIX2 WTIP "Wilms tumor protein 1-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ENH9 WTIP "Wilms tumor protein 1-interacting protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2141920 Wtip "WT1-interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIC6 WTIP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP33 E1BP33 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306411 Wtip "Wilms tumor 1 interacting protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-261 wtip "Wilms tumor 1 interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK57 LIMD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A8DZE6WTIP_DANRENo assigned EC number0.66270.42900.3595yesN/A
B7ZUL2LIMD1_XENTRNo assigned EC number0.57580.43270.3962yesN/A
A6NIX2WTIP_HUMANNo assigned EC number0.55770.51560.6511yesN/A
Q9VY77AJUBA_DROMENo assigned EC number0.71950.54690.4079yesN/A
G5E5X0LIMD1_BOVINNo assigned EC number0.58140.45110.3635yesN/A
Q7TQJ8WTIP_MOUSENo assigned EC number0.63050.41800.5703yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
cd0943862 cd09438, LIM3_Ajuba_like, The third LIM domain of 2e-35
cd0935553 cd09355, LIM2_Ajuba_like, The second LIM domain of 2e-35
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 4e-32
cd0935763 cd09357, LIM3_Zyxin_like, The third LIM domain of 4e-24
cd0935460 cd09354, LIM2_LPP, The second LIM domain of lipoma 1e-20
cd0935653 cd09356, LIM2_TRIP6, The second LIM domain of Thyr 6e-19
cd0943666 cd09436, LIM3_TRIP6, The third LIM domain of Thyro 1e-18
cd0943768 cd09437, LIM3_LPP, The third LIM domain of lipoma 8e-18
cd0943567 cd09435, LIM3_Zyxin, The third LIM domain of Zyxin 3e-17
cd0935360 cd09353, LIM2_Zyxin, The second LIM domain of Zyxi 3e-16
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 6e-15
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 2e-14
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 4e-13
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 5e-13
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 1e-12
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 1e-12
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-12
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 5e-11
pfam0041258 pfam00412, LIM, LIM domain 1e-10
pfam0041258 pfam00412, LIM, LIM domain 2e-10
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 4e-09
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 4e-09
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 9e-09
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 3e-08
pfam0041258 pfam00412, LIM, LIM domain 3e-08
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 3e-08
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 1e-07
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 1e-07
cd0946154 cd09461, LIM3_Enigma_like_1, The third LIM domain 1e-07
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 2e-07
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 2e-07
cd0935553 cd09355, LIM2_Ajuba_like, The second LIM domain of 3e-07
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 4e-07
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 5e-07
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 5e-07
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 6e-07
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 2e-06
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 2e-06
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 2e-06
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 3e-06
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 4e-06
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 5e-06
cd0945855 cd09458, LIM3_Enigma, The third LIM domain of Enig 7e-06
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 1e-05
cd0937354 cd09373, LIM1_AWH, The first LIM domain of Arrowhe 1e-05
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 2e-05
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 2e-05
cd0945053 cd09450, LIM_ALP, This family represents the LIM d 2e-05
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 2e-05
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 2e-05
cd0935853 cd09358, LIM_Mical_like, The LIM domain of Mical ( 3e-05
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 3e-05
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 3e-05
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 4e-05
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 4e-05
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 4e-05
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 4e-05
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-05
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 6e-05
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 6e-05
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 6e-05
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 7e-05
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 8e-05
cd0945452 cd09454, LIM1_ZASP_Cypher, The first LIM domain of 8e-05
cd0934257 cd09342, LIM3_Testin_like, The third LIM domain of 8e-05
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 1e-04
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 1e-04
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 1e-04
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 1e-04
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 1e-04
cd0940852 cd09408, LIM2_Leupaxin, The second LIM domain of L 1e-04
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 2e-04
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 2e-04
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 2e-04
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 3e-04
cd0942458 cd09424, LIM2_FHL1, The second LIM domain of Four 3e-04
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 3e-04
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 4e-04
cd0941458 cd09414, LIM1_LIMPETin, The first LIM domain of pr 4e-04
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 5e-04
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 5e-04
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 6e-04
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 6e-04
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 7e-04
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 8e-04
cd0943256 cd09432, LIM6_LIMPETin, The sixth LIM domain of pr 8e-04
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 8e-04
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 8e-04
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 0.001
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 0.001
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 0.001
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.001
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 0.001
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 0.001
cd0945252 cd09452, LIM1_Enigma, The first LIM domain of Enig 0.001
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 0.001
cd0935653 cd09356, LIM2_TRIP6, The second LIM domain of Thyr 0.002
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 0.002
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 0.002
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 0.002
cd0933056 cd09330, LIM4_abLIM, The fourth LIM domain of acti 0.002
cd0942059 cd09420, LIM3_Prickle, The third LIM domain of Pri 0.002
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 0.002
cd0933952 cd09339, LIM4_Paxillin_like, The fourth LIM domain 0.002
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 0.002
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 0.003
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 0.003
cd0940354 cd09403, LIM2_CRP, The second LIM domain of Cystei 0.003
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 0.003
cd0934864 cd09348, LIM4_FHL1, The fourth LIM domain of Four 0.003
cd0943955 cd09439, LIM_Mical, The LIM domain of Mical (molec 0.003
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 0.003
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 0.003
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 0.004
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 0.004
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 0.004
cd0941559 cd09415, LIM1_Prickle, The first LIM domain of Pri 0.004
cd0936852 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L 0.004
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 0.004
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 0.004
>gnl|CDD|188822 cd09438, LIM3_Ajuba_like, The third LIM domain of Ajuba-like proteins Back     alignment and domain information 
 Score =  126 bits (319), Expect = 2e-35
 Identities = 44/62 (70%), Positives = 51/62 (82%)

Query: 465 CAACGKGITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTDEPDKRCYPLQGRLMCRA 524
           CAACG+ I P EG+EET+RVVSMDKD+HV+CY CEDCGLQL DE   RCYPL G L+C +
Sbjct: 1   CAACGQPILPAEGSEETIRVVSMDKDYHVECYHCEDCGLQLNDEEGHRCYPLDGHLLCHS 60

Query: 525 CH 526
           CH
Sbjct: 61  CH 62

The third LIM domain of Ajuba-like proteins: Ajuba like LIM protein family includes three highly homologous proteins Ajuba, Limd1, and WTIP. Members of the family contain three tandem C-terminal LIM domains and a proline-rich N-terminal region. This family of proteins functions as scaffolds, participating in the assembly of numerous protein complexes. In the cytoplasm, Ajuba binds Grb2 to modulate serum-stimulated ERK activation. Ajuba also recruits the TNF receptor-associated factor 6 (TRAF6) to p62 and activates PKCKappa activity. Ajuba interacts with alpha-catenin and F-actin to contribute to the formation or stabilization of adheren junctions by linking adhesive receptors to the actin cytoskeleton. Although Ajuba is a cytoplasmic protein, it can shuttle into the nucleus. In nucleus, Ajuba functions as a corepressor for the zinc finger-protein Snail. It binds to the SNAG repression domain of Snail through its LIM region. Arginine methyltransferase-5 (Prmt5), a protein in the complex, is recruited to Snai l through an interaction with Ajuba. This ternary complex functions to repress E-cadherin, a Snail target gene. In addition, Ajuba contains functional nuclear-receptor interacting motifs and selectively interacts with retinoic acid receptors (RARs) and rexinoid receptor (RXRs) to negatively regulate retinoic acid signaling. Wtip, the Wt1-interacting protein, was originally identified as an interaction partner of the Wilms tumour protein 1 (WT1). Wtip is involved in kidney and neural crest development. Wtip interacts with the receptor tyrosine kinase Ror2 and inhibits canonical Wnt signaling. LIMD1 was reported to inhibit cell growth and metastases. The inhibition may be mediated through an interaction with the protein barrier-to-autointegration (BAF), a component of SWI/SNF chromatin-remodeling protein; or through the interaction with retinoblastoma protein (pRB), resulting in inhibition of E2F-mediated transcription, and expression of the majority of genes with E2F1- responsive elements. Recently, Limd1 was shown to interact with the p62/sequestosome protein and influence IL-1 and RANKL signaling by facilitating the assembly of a p62/TRAF6/a-PKC multi-protein complex. The Limd1-p62 interaction affects both NF-kappaB and AP-1 activity in epithelial cells and osteoclasts. Moreover, LIMD1 functions as tumor repressor to block lung tumor cell line in vitro and in vivo. Recent studies revealed that LIM proteins Wtip, LIMD1 and Ajuba interact with components of RNA induced silencing complexes (RISC) as well as eIF4E and the mRNA m7GTP cap-protein complex and are required for microRNA-mediated gene silencing. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 62
>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188743 cd09357, LIM3_Zyxin_like, The third LIM domain of Zyxin-like family Back     alignment and domain information
>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188820 cd09436, LIM3_TRIP6, The third LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188821 cd09437, LIM3_LPP, The third LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188819 cd09435, LIM3_Zyxin, The third LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188716 cd09330, LIM4_abLIM, The fourth LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188804 cd09420, LIM3_Prickle, The third LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family Back     alignment and domain information
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein (CRP) Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting with CasL) Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 543
KOG1701|consensus468 100.0
KOG2272|consensus332 99.94
KOG2272|consensus332 99.9
KOG1044|consensus 670 99.89
KOG1703|consensus479 99.89
KOG4577|consensus 383 99.75
KOG1701|consensus468 99.71
KOG1703|consensus479 99.7
KOG4577|consensus 383 99.68
KOG1044|consensus 670 99.65
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.17
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.03
KOG1700|consensus200 98.97
KOG1700|consensus200 98.91
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.21
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.0
KOG0490|consensus235 97.02
KOG0490|consensus 235 96.95
KOG1702|consensus264 96.95
KOG1702|consensus 264 96.22
>KOG1701|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-43  Score=365.22  Aligned_cols=195  Identities=55%  Similarity=1.230  Sum_probs=182.3

Q ss_pred             cCccccccccCCceeecCcceeeccCceeccCCcccCccCCCCCCCceeeeCCeeeeccccccccccccchhhhccccch
Q psy14113        312 EGEYFGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLI  391 (543)
Q Consensus       312 ~~~~~~~C~~C~k~I~g~~~~v~a~gk~wH~~CF~Cs~C~~~L~~~~f~~~dG~~yC~~cY~~~~~~~fa~kCa~C~~~I  391 (543)
                      ..+++.+|.+|+|.|.+.+..++||++.||..||+|..|++.|.++.||.+|+++|||.||.     .            
T Consensus       270 ~~~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq-----~------------  332 (468)
T KOG1701|consen  270 VEDYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQ-----D------------  332 (468)
T ss_pred             hhhhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHH-----H------------
Confidence            45667799999999999999999999999999999999999999999999999999999994     2            


Q ss_pred             hhhhcccccccccccccCccceeeeeeccCccccCcCccCCCCCCCCCCCceeeeecCceeccchhhhhccccccccCCC
Q psy14113        392 MEMYSGFQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKG  471 (543)
Q Consensus       392 ~~~~s~~~~~~~~C~~C~k~I~~~~v~a~gk~wH~~CF~Cs~C~~~L~g~~f~v~~dGkpYC~~CY~k~f~pkC~~C~k~  471 (543)
                               ++.+|..|++.|++++++|+|+.||+.||+|..|++.|.|..|+++.++++||..||+++|+++|+.|+++
T Consensus       333 ---------tlekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~P  403 (468)
T KOG1701|consen  333 ---------TLEKCNKCGEPIMDRILRALGKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNP  403 (468)
T ss_pred             ---------HHHHHhhhhhHHHHHHHHhcccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCC
Confidence                     34456788888889999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCcceEEEEeCCCcccCCCCccCCCCCcCCC-CCCcceeecCCcccCchhhhhhhhc
Q psy14113        472 ITPVEGTEETVRVVSMDKDFHVDCYMCEDCGLQLTD-EPDKRCYPLQGRLMCRACHLSHLSR  532 (543)
Q Consensus       472 I~~~eg~~e~~~v~a~dk~yH~~CF~C~~C~k~L~~-~~~~~~~~~dg~~yC~~C~~~~~~~  532 (543)
                      |++.+|.+|+++|+++|+.||.+||+|++|++.|.. +++.+||.+|++|+|+.||.++++.
T Consensus       404 I~P~~G~~etvRvvamdr~fHv~CY~CEDCg~~LS~e~e~qgCyPld~HllCk~Ch~~Rl~~  465 (468)
T KOG1701|consen  404 ILPRDGKDETVRVVAMDRDFHVNCYKCEDCGLLLSSEEEGQGCYPLDGHLLCKTCHLKRLQA  465 (468)
T ss_pred             ccCCCCCcceEEEEEccccccccceehhhcCccccccCCCCcceeccCceeechhhhhhhcc
Confidence            999999999999999999999999999999999994 4447999999999999999998864

>KOG2272|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
2dlo_A81 Solution Structure Of The Second Lim Domain Of Huma 4e-17
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 1e-08
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 6e-08
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 1e-07
1cxx_A113 Mutant R122a Of Quail Cysteine And Glycine-Rich Pro 9e-06
1qli_A113 Quail Cysteine And Glycine-Rich Protein, Nmr, 15 Mi 1e-05
1x61_A72 Solution Structure Of The First Lim Domain Of Thyro 3e-05
3ixe_B72 Structural Basis Of Competition Between Pinch1 And 3e-05
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 7e-05
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 8e-05
1g47_A77 1st Lim Domain Of Pinch Protein Length = 77 2e-04
1ctl_A85 Structure Of The Carboxy-Terminal Lim Domain From T 2e-04
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 2e-04
2d8x_A70 Solution Structure Of The Second Lim Domain Of Part 3e-04
>pdb|2DLO|A Chain A, Solution Structure Of The Second Lim Domain Of Human Thyroid Receptor-Interacting Protein 6 Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%)
Query: 398 FQQTAEKCAICGHLIMEMILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDY 457
           +  T EKCA C   I++ IL+AMGK+YHPGCF C +C+  LDG+PFTVD  ++I+C+ D+
Sbjct: 11  YVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDF 70
Query: 458 HRMFA 462
           HR FA
Sbjct: 71  HRKFA 75
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 Back     alignment and structure
>pdb|1QLI|A Chain A, Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Average Structure Length = 113 Back     alignment and structure
>pdb|1X61|A Chain A, Solution Structure Of The First Lim Domain Of Thyroid Receptor Interacting Protein 6 (Trip6) Length = 72 Back     alignment and structure
>pdb|3IXE|B Chain B, Structural Basis Of Competition Between Pinch1 And Pinch2 For Binding To The Ankyrin Repeat Domain Of Integrin-Linked Kinase Length = 72 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 Back     alignment and structure
>pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 Back     alignment and structure
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure
>pdb|2D8X|A Chain A, Solution Structure Of The Second Lim Domain Of Particularly Interesting New Cys-His Protein (Pinch) Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 7e-35
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-13
1b8t_A 192 Protein (CRP1); LIM domain, muscle differentiation 1e-07
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 3e-34
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 3e-29
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-05
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-30
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-30
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-10
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-06
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-30
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 2e-25
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-30
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-25
1rut_X 188 Flinc4, fusion protein of LMO4 protein and LIM dom 3e-07
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-29
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-12
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 3e-09
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-29
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-26
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 8e-12
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 8e-07
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 8e-27
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 4e-23
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 2e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 5e-06
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-22
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 1e-13
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 8e-13
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 4e-22
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-18
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 3e-10
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 5e-22
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-13
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 7e-08
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 6e-22
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 4e-13
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 1e-06
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-21
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-15
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 3e-07
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-21
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-12
2cuq_A80 Four and A half LIM domains 3; structural genomics 2e-12
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-21
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 2e-13
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 5e-07
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 6e-21
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 7e-17
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 5e-09
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 1e-20
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 8e-11
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 9e-09
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 2e-20
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 3e-12
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 9e-07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 2e-20
3f6q_B72 LIM and senescent cell antigen-like-containing dom 4e-16
3f6q_B72 LIM and senescent cell antigen-like-containing dom 6e-10
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-20
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 7e-14
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 5e-09
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-19
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 2e-13
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 9e-11
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-19
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-16
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-08
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 2e-19
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 7e-10
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 2e-06
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-19
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-14
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 1e-08
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 8e-19
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 3e-14
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-12
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 1e-18
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 9e-17
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 4e-08
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-18
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-13
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 7e-08
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-17
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 3e-14
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 4e-13
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 3e-17
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-10
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 3e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 6e-16
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 1e-11
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 2e-06
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-15
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 4e-14
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 3e-12
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 2e-15
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 7e-09
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 6e-07
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-15
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-12
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 2e-10
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 3e-14
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 2e-08
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 4e-07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-13
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 3e-10
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-07
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-12
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 4e-09
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-08
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-12
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 3e-12
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 4e-08
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-12
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-08
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-04
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 7e-12
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 1e-11
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 3e-11
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 6e-09
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 7e-06
2co8_A82 NEDD9 interacting protein with calponin homology a 8e-08
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-07
2co8_A82 NEDD9 interacting protein with calponin homology a 9e-06
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 1e-06
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 3e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
 Score =  128 bits (324), Expect = 7e-35
 Identities = 41/178 (23%), Positives = 63/178 (35%), Gaps = 26/178 (14%)

Query: 319 CHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQ 378
           C  C + V    +  Q  G+ +H +CF+C  C + L           +YC+  Y      
Sbjct: 10  CGVCQKAVYF-AEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGP 68

Query: 379 QTAEKCAICGHLIMEM-----------------------YSGFQQTAEKCAICGHLIMEM 415
           +   K    G L  +                         +     ++ C  CG  +   
Sbjct: 69  KGKGKGMGAGTLSTDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYAA 128

Query: 416 -ILQAMGKSYHPGCFRCCLCNECLDGVPFTVDVDNKIYCVNDYHRMFAPKCAACGKGI 472
             +   GKS+H  CFRC  C + L+      D D +IYC   Y + F PK    G+G 
Sbjct: 129 EKVIGAGKSWHKSCFRCAKCGKSLESTTLA-DKDGEIYCKGCYAKNFGPKGFGFGQGA 185
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.92
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.9
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.89
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.89
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.89
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.89
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.88
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.88
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.88
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.87
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.87
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.85
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.82
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.81
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.68
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.66
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.62
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.6
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.59
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.58
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.58
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.55
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.54
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.54
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.54
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.53
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.53
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.52
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.52
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.49
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.45
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.44
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.43
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.42
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.41
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.41
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.41
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.39
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.39
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.39
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.39
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.38
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.38
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.37
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.37
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.37
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.36
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.35
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.35
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.33
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.33
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.33
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.32
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.32
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.32
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.32
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.31
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.3
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.3
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.29
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.29
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.29
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.29
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.29
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.28
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.27
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.24
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.23
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.23
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.23
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.22
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.22
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.22
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.2
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.19
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.19
2co8_A82 NEDD9 interacting protein with calponin homology a 99.18
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.18
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.16
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.15
2co8_A82 NEDD9 interacting protein with calponin homology a 99.14
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.11
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.11
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.08
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 96.73
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 96.24
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
Probab=99.92  E-value=5.7e-26  Score=217.73  Aligned_cols=152  Identities=28%  Similarity=0.560  Sum_probs=128.9

Q ss_pred             ccccccCCceeecCcceeeccCceeccCCcccCccCCCCCCCceeeeCCeeeeccccccccccccchhhhccccchhhhh
Q psy14113        316 FGICHTCGEKVTGAGQACQAMGNLYHTNCFICCSCGRALRGKAFYNVHGRVYCEEDYLYSGFQQTAEKCAICGHLIMEMY  395 (543)
Q Consensus       316 ~~~C~~C~k~I~g~~~~v~a~gk~wH~~CF~Cs~C~~~L~~~~f~~~dG~~yC~~cY~~~~~~~fa~kCa~C~~~I~~~~  395 (543)
                      .++|.+|++.|...+ .+.++|+.||++||+|..|+++|.+..|+.++|++||+.||.    ++|+++|..|++......
T Consensus         7 ~~~C~~C~~~I~~~~-~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~----~~f~~~c~~c~~~~g~~~   81 (192)
T 1b8t_A            7 GKKCGVCQKAVYFAE-EVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYG----KKYGPKGKGKGMGAGTLS   81 (192)
T ss_dssp             CEECTTTCCEECSSC-CEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHH----HHHSCCCCCCCCCCCCCC
T ss_pred             CCcCccCCCeeccee-EEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhH----hhcCccccccccccccEe
Confidence            468999999997544 578999999999999999999999989999999999999998    789999988875421000


Q ss_pred             ------------------------ccc---ccccccccccCcccee-eeeeccCccccCcCccCCCCCCCCCCCceeeee
Q psy14113        396 ------------------------SGF---QQTAEKCAICGHLIME-MILQAMGKSYHPGCFRCCLCNECLDGVPFTVDV  447 (543)
Q Consensus       396 ------------------------s~~---~~~~~~C~~C~k~I~~-~~v~a~gk~wH~~CF~Cs~C~~~L~g~~f~v~~  447 (543)
                                              +.+   -.+.++|.+|++.|.+ +.+.++++.||.+||+|..|+++|.+..|+ .+
T Consensus        82 ~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~-~~  160 (192)
T 1b8t_A           82 TDKGESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLA-DK  160 (192)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEE-EE
T ss_pred             cCCCcccccccccccccCCCCcCccccccccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCccc-cc
Confidence                                    000   0125679999999984 677899999999999999999999877775 68


Q ss_pred             cCceeccchhhhhccccccccCCCCC
Q psy14113        448 DNKIYCVNDYHRMFAPKCAACGKGIT  473 (543)
Q Consensus       448 dGkpYC~~CY~k~f~pkC~~C~k~I~  473 (543)
                      +|++||+.||.++|+++|.+|++++-
T Consensus       161 ~g~~yC~~cy~~~f~~kc~~C~~~~g  186 (192)
T 1b8t_A          161 DGEIYCKGCYAKNFGPKGFGFGQGAG  186 (192)
T ss_dssp             TTEEEEHHHHHHHTCCCCCCCCCCCC
T ss_pred             CCEEeCHHHHHHhcCCcCCCCCCccc
Confidence            99999999999999999999999863
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 543
d2dloa233 g.39.1.3 (A:43-75) Thyroid receptor interacting pr 1e-14
d2dloa135 g.39.1.3 (A:8-42) Thyroid receptor interacting pro 1e-13
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 6e-08
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 3e-07
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 3e-05
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 3e-04
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 1e-04
d1x61a232 g.39.1.3 (A:35-66) Thyroid receptor interacting pr 0.002
d1v6ga141 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abL 0.003
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 0.004
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Thyroid receptor interacting protein 6, TRIP6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 65.9 bits (161), Expect = 1e-14
 Identities = 17/32 (53%), Positives = 25/32 (78%)

Query: 431 CCLCNECLDGVPFTVDVDNKIYCVNDYHRMFA 462
           C +C+  LDG+PFTVD  ++I+C+ D+HR FA
Sbjct: 2   CVVCHRGLDGIPFTVDATSQIHCIEDFHRKFA 33
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.27
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.25
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.02
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.01
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.01
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.96
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.89
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.83
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.64
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.55
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.51
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 97.47
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 97.42
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.41
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.41
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.36
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.35
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.34
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.28
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.27
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.18
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.18
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.13
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.09
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.08
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.06
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.03
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.0
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 96.91
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 96.9
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 96.86
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 96.85
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.83
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 96.82
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.79
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.77
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.77
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.76
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 96.76
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 96.76
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.76
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.74
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 96.73
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 96.72
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.7
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 96.69
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.66
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 96.66
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 96.65
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 96.65
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 96.63
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.62
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 96.57
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.55
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.54
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 96.51
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.51
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.41
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 96.33
d2co8a236 Nedd9 interacting protein with calponin homology, 96.29
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 96.29
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.24
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.22
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 96.1
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.08
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.05
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 96.03
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.99
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.99
d2co8a236 Nedd9 interacting protein with calponin homology, 95.78
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 95.72
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 95.53
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 95.41
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 95.38
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 95.36
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 95.32
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.28
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.25
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.21
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 95.17
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.74
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 94.68
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 94.66
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.56
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 94.56
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 94.5
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 94.36
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 94.28
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.14
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 94.14
d2cora131 Pinch (particularly interesting new Cys-His) prote 93.92
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 93.86
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 93.84
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 93.38
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 93.34
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 93.04
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 92.79
d1g47a135 Pinch (particularly interesting new Cys-His) prote 91.85
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 91.77
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 91.65
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 91.12
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 90.57
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 90.52
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 90.47
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 90.31
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 90.12
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 90.04
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 89.69
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 88.39
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 87.61
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 85.91
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 85.51
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 83.67
d2cora131 Pinch (particularly interesting new Cys-His) prote 82.37
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 80.21
d1g47a135 Pinch (particularly interesting new Cys-His) prote 80.05
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.53  E-value=1.2e-08  Score=70.14  Aligned_cols=35  Identities=31%  Similarity=0.850  Sum_probs=31.7

Q ss_pred             chhhhhccccccccCCCCCCCCCCcceEEEEeCCCcccCCCC
Q psy14113        455 NDYHRMFAPKCAACGKGITPVEGTEETVRVVSMDKDFHVDCY  496 (543)
Q Consensus       455 ~CY~k~f~pkC~~C~k~I~~~eg~~e~~~v~a~dk~yH~~CF  496 (543)
                      ++|.++|+++|.+|+++|.+.       .|+++++.||++||
T Consensus         1 ~DY~~~fapkC~~C~~~I~g~-------~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           1 KDFLAMFSPKCGGCNRPVLEN-------YLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCCSCBCTTTCCBCCSS-------CEEETTEEECTTTC
T ss_pred             CcHHHHhChhhhhcCCcccch-------heeecCCccCcccC
Confidence            478999999999999999853       58899999999998
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure