Diaphorina citri psyllid: psy14114


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MKQFVKDAGSALSRVVQLTEEKLGTSEKTELDAHFESLAGRSDVTKLWTEKIVGDTAAVLTPNPGNRVEDFLFEKIEKKRPSRLSNLEYLGLDMTEAGNAFGPGTTYGTALIKVGQYEQKLGAAEREFVNSAHVSFVQPLQKFLEGEMKTIVKERSLLESKRLDLDSCKNRVRKARSLLGTQSNAERDLRIAQSEFDRQAEITKLLLEGVQTSHTSHLRCLHEFVEAQVNYYANCHKIMQDLKNELSK
cccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*******AGSALSRVVQ****************HFESLAGRSDVTKLWTEKIVGDTAAVLTPNPGNRVEDFLFEKIE*****RLSNLEYLGLDMTEAGNAFGPGTTYGTALIKVGQYEQKLGAAEREFVNSAHVSFVQPLQKFLEGEMKTIVKERSLLESKRLDLDS**************************SEFDRQAEITKLLLEGVQTSHTSHLRCLHEFVEAQVNYYANCHKIMQDLKNE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQFVKDAGSALSRVVQLTEEKLGTSEKTELDAHFESLAGRSDVTKLWTEKIVGDTAAVLTPNPGNRVEDFLFEKIEKKRPSRLSNLEYLGLDMTEAGNAFGPGTTYGTALIKVGQYEQKLGAAEREFVNSAHVSFVQPLQKFLEGEMKTIVKERSLLESKRLDLDSCKNRVRKARSLLGTQSNAERDLRIAQSEFDRQAEITKLLLEGVQTSHTSHLRCLHEFVEAQVNYYANCHKIMQDLKNELSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Endophilin-B1 May be required for normal outer mitochondrial membrane dynamics. Required for coatomer-mediated retrograde transport in certain cells. May recruit other proteins to membranes with high curvature. May promote membrane fusion.confidentQ6AYE2
Endophilin-B1 May be required for normal outer mitochondrial membrane dynamics. Required for coatomer-mediated retrograde transport in certain cells. May recruit other proteins to membranes with high curvature. May promote membrane fusion.confidentQ9JK48
Endophilin-B1 May be required for normal outer mitochondrial membrane dynamics. Required for coatomer-mediated retrograde transport in certain cells. May recruit other proteins to membranes with high curvature. May promote membrane fusion.confidentQ5ZIR1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0051084 [BP]'de novo' posttranslational protein foldingprobableGO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0006458, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005504 [MF]fatty acid bindingprobableGO:0043168, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0033293
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0006654 [BP]phosphatidic acid biosynthetic processprobableGO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0046474, GO:0046473
GO:0032461 [BP]positive regulation of protein oligomerizationprobableGO:0051130, GO:0031334, GO:0051128, GO:0008150, GO:0044087, GO:0065007, GO:0048518, GO:0032459, GO:0043254, GO:0050794, GO:0050789, GO:0048522
GO:0042171 [MF]lysophosphatidic acid acyltransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0016411, GO:0008374, GO:0071617
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:1900740 [BP]positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathwayprobableGO:0060341, GO:0033043, GO:0051049, GO:0032386, GO:0010822, GO:0048583, GO:0051128, GO:0010821, GO:0023051, GO:0010646, GO:0042981, GO:0050789, GO:0032880, GO:0010941, GO:0009966, GO:2001233, GO:0043067, GO:0065007, GO:0048518, GO:1901028, GO:1900739, GO:0051130, GO:0070201, GO:0050794, GO:0008150, GO:0032879, GO:0010638, GO:0048522
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZWW, chain A
Confidence level:very confident
Coverage over the Query: 29-67,84-247
View the alignment between query and template
View the model in PyMOL