Diaphorina citri psyllid: psy14123


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MLYLLVFSIVLKPRPYLFILLVYFSENLNEFAHNNWRSFARHEYFDEKGMFISIVFSIPLLLNCMILVLKRKYTCKEPYPNLKTPLCLTPLLKNGFTYQLLN
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHHHHHHHHHHHccccHHccHHHHHHcHHHccccccccc
MLYLLVFSIVLKPRPYLFILLVYFSENLNEFAHNNWRSFARHEYFDEKGMFISIVFSIPLLLNCMILVLKRKYTCKEPYPNLKTPLCLTPLLKNGFTYQLLN
xxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYLLVFSIVLKPRPYLFILLVYFSENLNEFAHNNWRSFARHEYFDEKGMFISIVFSIPLLLNCMILVLKRKYTCKEPYPNLKTPLCLTPLLKNGFTYQLLN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transmembrane protein 18 Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).confidentQ3TUD9
Transmembrane protein 18 confidentQ641M3
Transmembrane protein 18 Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC).confidentQ3SZ36

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted