Diaphorina citri psyllid: psy14139


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MATSKTSSTYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVPGLPGALPPPPKDFFNLSNPVV
ccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHccccEEccEEEEEEEccccccccccHHHHHcccccccccccccccccccccccccccc
*********YNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIG*********************MKLARTTPYYKRNRPHICSFWVKGECRRG*************************YYGV********************PEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRA************************************NP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSKTSSTYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVPGLPGALPPPPKDFFNLSNPVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA-splicing factor RBM22 Involved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle. May be involved in early embryogenesis.very confidentQ6P616
Pre-mRNA-splicing factor RBM22 Involved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle. Involved in both translocations of the nuclear SLU7 to the cytoplasm and the cytosolic calcium-binding protein PDCD6 to the nucleus upon cellular stress responses.very confidentQ8BHS3
Pre-mRNA-splicing factor RBM22 Involved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle (By similarity). Involved in early embryogenesis.very confidentQ6NZZ9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005487 [MF]nucleocytoplasmic transporter activityconfidentGO:0005215, GO:0003674
GO:0071011 [CC]precatalytic spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeconfidentGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000060 [BP]protein import into nucleus, translocationconfidentGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0051641, GO:0034613, GO:0017038, GO:0006810, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0033554 [BP]cellular response to stressconfidentGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0045292 [BP]mRNA cis splicing, via spliceosomeconfidentGO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0033120 [BP]positive regulation of RNA splicingconfidentGO:0043484, GO:0045935, GO:0010604, GO:0019222, GO:0060255, GO:0031323, GO:0031325, GO:0051252, GO:0080090, GO:0051254, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0051173, GO:0048518, GO:0008150, GO:0048522, GO:0010468, GO:0009893
GO:0036002 [MF]pre-mRNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0017069 [MF]snRNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0090316 [BP]positive regulation of intracellular protein transportconfidentGO:0033157, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0051050, GO:0051049, GO:0032386, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0048306 [MF]calcium-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000381 [BP]regulation of alternative mRNA splicing, via spliceosomeprobableGO:0051252, GO:0080090, GO:0019222, GO:0060255, GO:0050684, GO:0043484, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0048024, GO:0008150, GO:0010468
GO:0007281 [BP]germ cell developmentprobableGO:0032502, GO:0044702, GO:0048609, GO:0032504, GO:0022414, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0019953, GO:0044767, GO:0003006, GO:0048610, GO:0044763, GO:0044699, GO:0022412, GO:0008150, GO:0009987, GO:0000003, GO:0007276, GO:0048856
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040020 [BP]regulation of meiosisprobableGO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U1L, chain A
Confidence level:very confident
Coverage over the Query: 134-199,210-286
View the alignment between query and template
View the model in PyMOL
Template: 1Y02, chain A
Confidence level:probable
Coverage over the Query: 25-70
View the alignment between query and template
View the model in PyMOL