Psyllid ID: psy14139


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MATSKTSSTYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVPGLPGALPPPPKDFFNLSNPVV
ccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccEEEEEEccHHHHHHHHHHHccccEEccEEEEEEEccccccccccHHHHHcccccccccccccccccccccccccccc
ccccccccccccccHHHHHHHHcccccEEEcccEEEEEEcccccccEcEEEEHHHHHHHHHHHHHHHHHHHccccHEHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccccccccccccccEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccEEEEEEccHHHHHHHHHHHcccEEEccEEEEEEEccccccccccHHHHccccccccccccccccccccccccccccc
matsktsstynrqswedatkekygkeckicarpftvfrwcpgarmrfkktEVCQTCARLKNVCQTCLldleyglpiqVRDTALkikddipksdvnkeyyIQNMdheigkidsttpagalgkasgsSEMLMKLARttpyykrnrphicsfwvkgecrrgeecpyrhekptdpddpladqnikdryygvndpVAEKLMARastmpkldppedktitTLYVgnlgdklteqDLRDHFYQFGEIRSVTILSKQQCAFIQytsrpaaeaAVEHSFNKVILggrrlnikwgraqanrgedTAELKVrlepvpglpgalppppkdffnlsnpvv
matsktsstynrqswedatkekygkeckicarpftvfrwcpGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTalkikddipksdvNKEYYIQNMDHEIGKIDSTTPAGALgkasgsseMLMKLARttpyykrnrphICSFWVKGecrrgeecpyrhekptdpddpladqNIKDRYYGVNDPVAEKLMARAstmpkldppedkTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVpglpgalppppkdffnlsnpvv
MATSKTSSTYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEpvpglpgalppppKDFFNLSNPVV
*********************KYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIG*********************MKLARTTPYYKRNRPHICSFWVKGECRRG*************************YYGV************************TITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRA****************************************
***S**S**YNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTA****************YIQNMDHEIG***************************************************************************************************PEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIK****************************************NP**
*********************KYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVPGLPGALPPPPKDFFNLSNPVV
********TYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKID*TTPA*ALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQ************RLEPVPGLPGALPPPPKDFFNLS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSKTSSTYNRQSWEDATKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRGEDTAELKVRLEPVPGLPGALPPPPKDFFNLSNPVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q4V7D7420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.734 1e-145
Q8BHS3420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.731 1e-144
Q4R4J1420 Pre-mRNA-splicing factor N/A N/A 0.932 0.726 0.731 1e-144
Q9NW64420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.731 1e-144
Q5RAY5420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.731 1e-144
Q5ZM16420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.728 1e-144
Q3B7L8420 Pre-mRNA-splicing factor yes N/A 0.932 0.726 0.731 1e-144
Q6P616417 Pre-mRNA-splicing factor yes N/A 0.932 0.731 0.716 1e-143
Q7ZXB5417 Pre-mRNA-splicing factor N/A N/A 0.932 0.731 0.710 1e-143
Q6NZZ9425 Pre-mRNA-splicing factor yes N/A 0.932 0.717 0.709 1e-141
>sp|Q4V7D7|RBM22_RAT Pre-mRNA-splicing factor RBM22 OS=Rattus norvegicus GN=Rbm22 PE=2 SV=1 Back     alignment and function desciption
 Score =  513 bits (1321), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 273/328 (83%), Gaps = 23/328 (7%)

Query: 1   MATSKTSSTYNRQSWEDA------------------TKEKYGKECKICARPFTVFRWCPG 42
           MATS  S+TYNRQ+WEDA                  TKEKYGKECKICARPFTVFRWCPG
Sbjct: 1   MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG 60

Query: 43  ARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQN 102
            RMRFKKTEVCQTC++LKNVCQTCLLDLEYGLPIQVRD  L  KDD+PKSDVNKEYY QN
Sbjct: 61  VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN 120

Query: 103 MDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECP 162
           M+ EI   D T P G LGKA+ +S+ML+KLARTTPYYKRNRPHICSFWVKGEC+RGEECP
Sbjct: 121 MEREISNSDGTRPVGMLGKATSTSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP 180

Query: 163 YRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLG 222
           YRHEKPTDPDDPLADQNIKDRYYG+NDPVA+KL+ RASTMP+LDPPEDKTITTLYVG LG
Sbjct: 181 YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPEDKTITTLYVGGLG 240

Query: 223 DKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNI 282
           D +TE DLR+HFYQFGEIR+VT++ +QQCAFIQ+ +R AAE A E SFNK+I+ GRRLN+
Sbjct: 241 DTITETDLRNHFYQFGEIRTVTVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV 300

Query: 283 KWGRAQANRGED-----TAELKVRLEPV 305
           KWGR+QA RG++     T +  ++LEPV
Sbjct: 301 KWGRSQAARGKEKEKDGTTDSGIKLEPV 328




Involved in the first step of pre-mRNA splicing. Binds directly to the internal stem-loop (ISL) domain of the U6 snRNA and to the pre-mRNA intron near the 5' splice site during the activation and catalytic phases of the spliceosome cycle. Involved in both translocations of the nuclear SLU7 to the cytoplasm and the cytosolic calcium-binding protein PDCD6 to the nucleus upon cellular stress responses.
Rattus norvegicus (taxid: 10116)
>sp|Q8BHS3|RBM22_MOUSE Pre-mRNA-splicing factor RBM22 OS=Mus musculus GN=Rbm22 PE=2 SV=1 Back     alignment and function description
>sp|Q4R4J1|RBM22_MACFA Pre-mRNA-splicing factor RBM22 OS=Macaca fascicularis GN=RBM22 PE=2 SV=1 Back     alignment and function description
>sp|Q9NW64|RBM22_HUMAN Pre-mRNA-splicing factor RBM22 OS=Homo sapiens GN=RBM22 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAY5|RBM22_PONAB Pre-mRNA-splicing factor RBM22 OS=Pongo abelii GN=RBM22 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZM16|RBM22_CHICK Pre-mRNA-splicing factor RBM22 OS=Gallus gallus GN=RBM22 PE=2 SV=1 Back     alignment and function description
>sp|Q3B7L8|RBM22_BOVIN Pre-mRNA-splicing factor RBM22 OS=Bos taurus GN=RBM22 PE=2 SV=1 Back     alignment and function description
>sp|Q6P616|RBM22_XENTR Pre-mRNA-splicing factor RBM22 OS=Xenopus tropicalis GN=rbm22 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZXB5|RBM22_XENLA Pre-mRNA-splicing factor RBM22 OS=Xenopus laevis GN=rbm22 PE=2 SV=1 Back     alignment and function description
>sp|Q6NZZ9|RBM22_DANRE Pre-mRNA-splicing factor RBM22 OS=Danio rerio GN=rbm22 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
405971196 434 Pre-mRNA-splicing factor RBM22 [Crassost 0.993 0.748 0.714 1e-147
291243067 429 PREDICTED: RNA binding motif protein 22- 0.972 0.741 0.715 1e-146
338713130421 PREDICTED: LOW QUALITY PROTEIN: pre-mRNA 0.951 0.738 0.730 1e-145
260830806 435 hypothetical protein BRAFLDRAFT_145268 [ 0.981 0.737 0.698 1e-145
307181748411 Pre-mRNA-splicing factor RBM22 [Camponot 0.932 0.742 0.771 1e-144
242011910 457 pre-mRNA-splicing factor SLT11, putative 0.972 0.695 0.729 1e-144
224067689420 PREDICTED: pre-mRNA-splicing factor RBM2 0.932 0.726 0.734 1e-144
383857285412 PREDICTED: pre-mRNA-splicing factor RBM2 0.932 0.740 0.768 1e-144
156546667409 PREDICTED: pre-mRNA-splicing factor RBM2 0.932 0.745 0.746 1e-143
340722791411 PREDICTED: pre-mRNA-splicing factor RBM2 0.932 0.742 0.768 1e-143
>gi|405971196|gb|EKC36046.1| Pre-mRNA-splicing factor RBM22 [Crassostrea gigas] Back     alignment and taxonomy information
 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 250/350 (71%), Positives = 288/350 (82%), Gaps = 25/350 (7%)

Query: 1   MATSKTSSTYNRQSWEDA------------------TKEKYGKECKICARPFTVFRWCPG 42
           MATSK ++TYNRQ+WEDA                   KEKYGKECKICARPFTVFRWCPG
Sbjct: 1   MATSKGANTYNRQNWEDAEFPILCQTCLGDNPYIRMMKEKYGKECKICARPFTVFRWCPG 60

Query: 43  ARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQN 102
           ARMRFKKTEVCQTC++LKNVCQTCLLDLEYGLP+QVRD ALK++D++PKSDVNKEYY QN
Sbjct: 61  ARMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPVQVRDAALKVQDNMPKSDVNKEYYTQN 120

Query: 103 MDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHICSFWVKGECRRGEECP 162
           M+ EI   D T P GALGKA   S+ML+KLARTTPYYKRNRPHICSFWVKGEC+RGEECP
Sbjct: 121 MEREIATNDGTAPGGALGKAMAPSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP 180

Query: 163 YRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLG 222
           YRHEKPTDPDDPLADQNIKDR+YG NDPVA+KL+ R + MPKL  PEDKTITTLY+GNLG
Sbjct: 181 YRHEKPTDPDDPLADQNIKDRFYGSNDPVADKLLQRYTDMPKLTLPEDKTITTLYIGNLG 240

Query: 223 DKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNI 282
           +K+ E++LRDHFYQFGEIR + +++KQQCAF+Q+TSR +AEAA E SFNK+I+GGRRL I
Sbjct: 241 EKIGEKELRDHFYQFGEIRMINVVAKQQCAFVQFTSRSSAEAAAEKSFNKLIVGGRRLTI 300

Query: 283 KWGRAQANR---GEDTAELKVRLEPVPGLPGALPPPPK----DFFNLSNP 325
           KWGR+Q  +    ++  E    LEPVPGLPGALP PP+    +FFNLSNP
Sbjct: 301 KWGRSQGQQLALKKEGEEDDKDLEPVPGLPGALPAPPEEIANNFFNLSNP 350




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|291243067|ref|XP_002741428.1| PREDICTED: RNA binding motif protein 22-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|338713130|ref|XP_001917686.2| PREDICTED: LOW QUALITY PROTEIN: pre-mRNA-splicing factor RBM22-like [Equus caballus] Back     alignment and taxonomy information
>gi|260830806|ref|XP_002610351.1| hypothetical protein BRAFLDRAFT_145268 [Branchiostoma floridae] gi|229295716|gb|EEN66361.1| hypothetical protein BRAFLDRAFT_145268 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|307181748|gb|EFN69209.1| Pre-mRNA-splicing factor RBM22 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|242011910|ref|XP_002426686.1| pre-mRNA-splicing factor SLT11, putative [Pediculus humanus corporis] gi|212510857|gb|EEB13948.1| pre-mRNA-splicing factor SLT11, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|224067689|ref|XP_002198708.1| PREDICTED: pre-mRNA-splicing factor RBM22 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|383857285|ref|XP_003704135.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156546667|ref|XP_001603806.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340722791|ref|XP_003399785.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Bombus terrestris] gi|350424167|ref|XP_003493709.1| PREDICTED: pre-mRNA-splicing factor RBM22-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
UNIPROTKB|F1NMD7420 RBM22 "Pre-mRNA-splicing facto 0.871 0.678 0.775 4e-129
RGD|1305770420 Rbm22 "RNA binding motif prote 0.844 0.657 0.804 1.1e-128
UNIPROTKB|Q5ZM16420 RBM22 "Pre-mRNA-splicing facto 0.871 0.678 0.772 1.4e-128
UNIPROTKB|F2Z4G3420 RBM22 "Pre-mRNA-splicing facto 0.844 0.657 0.800 1.4e-128
UNIPROTKB|Q9NW64420 RBM22 "Pre-mRNA-splicing facto 0.844 0.657 0.800 1.4e-128
UNIPROTKB|Q4R4J1420 RBM22 "Pre-mRNA-splicing facto 0.844 0.657 0.800 1.4e-128
UNIPROTKB|Q5RAY5420 RBM22 "Pre-mRNA-splicing facto 0.844 0.657 0.800 1.4e-128
MGI|MGI:1914060420 Rbm22 "RNA binding motif prote 0.844 0.657 0.800 1.4e-128
UNIPROTKB|Q3B7L8420 RBM22 "Pre-mRNA-splicing facto 0.844 0.657 0.800 2.2e-128
UNIPROTKB|E2RG35422 RBM22 "Uncharacterized protein 0.844 0.654 0.794 2e-127
UNIPROTKB|F1NMD7 RBM22 "Pre-mRNA-splicing factor RBM22" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1267 (451.1 bits), Expect = 4.0e-129, P = 4.0e-129
 Identities = 225/290 (77%), Positives = 256/290 (88%)

Query:    19 TKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTCLLDLEYGLPIQV 78
             TKEKYGKECKICARPFTVFRWCPG RMRFKKTEVCQTC++LKNVCQTCLLDLEYGLPIQV
Sbjct:    37 TKEKYGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQV 96

Query:    79 RDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPY 138
             RD  L +KD++PKSDVNKEYY QNM+ EI   D T P GALGKA+ +S+ML+KLARTTPY
Sbjct:    97 RDAGLSLKDEMPKSDVNKEYYTQNMEREIANSDGTRPVGALGKATSTSDMLLKLARTTPY 156

Query:   139 YKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMAR 198
             YKRNRPHICSFWVKGEC+RGEECPYRHEKPTDPDDPLADQNIKDRYYG+NDPVA+KL+ R
Sbjct:   157 YKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKR 216

Query:   199 ASTMPKLDPPEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTS 258
             ASTMP+LDPP+DKTITTLYVG LGD +TE DLR+HFYQFGEIR++T++ +QQCAFIQ+ +
Sbjct:   217 ASTMPRLDPPDDKTITTLYVGGLGDTITESDLRNHFYQFGEIRTITVVQRQQCAFIQFAT 276

Query:   259 RPAAEAAVEHSFNKVILGGRRLNIKWGRAQANRG-----EDTAELKVRLE 303
             R AAE A E SFNK+I+ GRRLN+KWGR+QA RG     E T E  ++LE
Sbjct:   277 RQAAEVAAEKSFNKLIVNGRRLNVKWGRSQAARGKEKDKEGTTESGIKLE 326




GO:0000166 "nucleotide binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000060 "protein import into nucleus, translocation" evidence=IEA
GO:0005487 "nucleocytoplasmic transporter activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0017069 "snRNA binding" evidence=IEA
GO:0033120 "positive regulation of RNA splicing" evidence=IEA
GO:0033554 "cellular response to stress" evidence=IEA
GO:0036002 "pre-mRNA binding" evidence=IEA
GO:0045292 "mRNA cis splicing, via spliceosome" evidence=IEA
GO:0048306 "calcium-dependent protein binding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IEA
GO:0090316 "positive regulation of intracellular protein transport" evidence=IEA
RGD|1305770 Rbm22 "RNA binding motif protein 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM16 RBM22 "Pre-mRNA-splicing factor RBM22" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4G3 RBM22 "Pre-mRNA-splicing factor RBM22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NW64 RBM22 "Pre-mRNA-splicing factor RBM22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R4J1 RBM22 "Pre-mRNA-splicing factor RBM22" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAY5 RBM22 "Pre-mRNA-splicing factor RBM22" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1914060 Rbm22 "RNA binding motif protein 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B7L8 RBM22 "Pre-mRNA-splicing factor RBM22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RG35 RBM22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4V7D7RBM22_RATNo assigned EC number0.73470.93270.7261yesN/A
Q6NZZ9RBM22_DANRENo assigned EC number0.70940.93270.7176yesN/A
Q5ZM16RBM22_CHICKNo assigned EC number0.72860.93270.7261yesN/A
Q8I4V2RBM22_PLAF7No assigned EC number0.36740.76450.7002yesN/A
Q8BHS3RBM22_MOUSENo assigned EC number0.73170.93270.7261yesN/A
Q4R4J1RBM22_MACFANo assigned EC number0.73170.93270.7261N/AN/A
Q6C3L4SLT11_YARLINo assigned EC number0.31560.77980.7162yesN/A
Q9LNV5C3H4_ARATHNo assigned EC number0.51920.89900.6112yesN/A
Q5AX35SLT11_EMENINo assigned EC number0.35290.78280.6790yesN/A
Q5SNN4C3H40_ORYSJNo assigned EC number0.57550.82260.5580yesN/A
Q7ZXB5RBM22_XENLANo assigned EC number0.71030.93270.7314N/AN/A
P0CR50SLT11_CRYNJNo assigned EC number0.46760.82260.8251yesN/A
O59800SLT11_SCHPONo assigned EC number0.30160.79200.7316yesN/A
Q6P616RBM22_XENTRNo assigned EC number0.71640.93270.7314yesN/A
Q3B7L8RBM22_BOVINNo assigned EC number0.73170.93270.7261yesN/A
Q4W9V0SLT11_ASPFUNo assigned EC number0.34690.76450.6527yesN/A
Q9NW64RBM22_HUMANNo assigned EC number0.73170.93270.7261yesN/A
Q5RAY5RBM22_PONABNo assigned EC number0.73170.93270.7261yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-46
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-17
smart0036073 smart00360, RRM, RNA recognition motif 6e-17
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 4e-14
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 8e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-13
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 3e-13
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 9e-13
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-12
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-12
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 4e-12
cd1236078 cd12360, RRM_cwf2, RNA recognition motif in yeast 6e-12
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-11
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-10
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 1e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-09
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-08
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-08
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-08
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 2e-08
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-08
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 3e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-08
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 6e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 6e-08
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-07
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 1e-07
cd1246279 cd12462, RRM_SCAF8, RNA recognition motif in SR-re 3e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 4e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 4e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-07
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 4e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 5e-07
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 5e-07
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 8e-07
cd1252074 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA 8e-07
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 8e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-06
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-06
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 2e-06
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 2e-06
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-06
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 2e-06
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 2e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-06
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 3e-06
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 3e-06
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 4e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 4e-06
cd1268980 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 4e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 5e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 7e-06
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 8e-06
smart0035627 smart00356, ZnF_C3H1, zinc finger 9e-06
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-05
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 1e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-05
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-05
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 1e-05
cd1246181 cd12461, RRM_SCAF4, RNA recognition motif found in 1e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 2e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-05
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-05
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-05
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-05
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 2e-05
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-05
cd1225872 cd12258, RRM2_RBM26_like, RNA recognition motif 2 2e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-05
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 2e-05
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-05
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-05
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 3e-05
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-05
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 4e-05
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 4e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 5e-05
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 5e-05
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 5e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 5e-05
cd1233179 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif 6e-05
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 6e-05
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 6e-05
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 6e-05
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 8e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 9e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 1e-04
cd1255876 cd12558, RRM3_RBM15B, RNA recognition motif 3 in p 1e-04
cd1229275 cd12292, RRM2_La_like, RNA recognition motif 2 in 1e-04
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-04
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 1e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 1e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 1e-04
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-04
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-04
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 2e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 2e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-04
cd1271676 cd12716, RRM1_2_NP220, RNA recognition motif 1 and 2e-04
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-04
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 2e-04
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 2e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-04
cd1224874 cd12248, RRM_RBM44, RNA recognition motif in RNA-b 3e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 3e-04
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 3e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-04
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-04
cd1255773 cd12557, RRM3_RBM15, RNA recognition motif 3 in ve 3e-04
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 4e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 4e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 4e-04
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 4e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 4e-04
cd1226173 cd12261, RRM1_3_MRN1, RNA recognition motif 1 and 5e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 6e-04
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 6e-04
cd1226969 cd12269, RRM_Vip1_like, RNA recognition motif in a 6e-04
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 6e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 6e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 6e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 7e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 7e-04
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 9e-04
PLN03120 260 PLN03120, PLN03120, nucleic acid binding protein; 9e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 0.001
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.001
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 0.001
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 0.001
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 0.002
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.002
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.002
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 0.002
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 0.003
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.003
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 0.003
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 0.003
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.003
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 0.003
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.003
cd1262577 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in 0.003
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 0.003
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.003
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.003
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 0.003
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 0.004
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.004
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 0.004
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 0.004
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
 Score =  151 bits (383), Expect = 2e-46
 Identities = 50/74 (67%), Positives = 64/74 (86%)

Query: 213 ITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNK 272
           ITTLYVG LG+++TE+DLRDHFYQFGEIRS+T++ +QQCAF+ +T+R AAE A E  FNK
Sbjct: 1   ITTLYVGGLGERVTEKDLRDHFYQFGEIRSITVVPRQQCAFVTFTTREAAEKAAERLFNK 60

Query: 273 VILGGRRLNIKWGR 286
           +I+ GRRL +KWGR
Sbjct: 61  LIINGRRLKLKWGR 74


This subgroup corresponds to the RRM of RBM22 (also known as RNA-binding motif protein 22, or Zinc finger CCCH domain-containing protein 16), a newly discovered RNA-binding motif protein which belongs to the SLT11 gene family. SLT11 gene encoding protein (Slt11p) is a splicing factor in yeast, which is required for spliceosome assembly. Slt11p has two distinct biochemical properties: RNA-annealing and RNA-binding activities. RBM22 is the homolog of SLT11 in vertebrate. It has been reported to be involved in pre-splicesome assembly and to interact with the Ca2+-signaling protein ALG-2. It also plays an important role in embryogenesis. RBM22 contains a conserved RNA recognition motif (RRM), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), a zinc finger of the unusual type C-x8-C-x5-C-x3-H, and a C-terminus that is unusually rich in the amino acids Gly and Pro, including sequences of tetraprolines. Length = 74

>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240806 cd12360, RRM_cwf2, RNA recognition motif in yeast pre-mRNA-splicing factor Cwc2 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240964 cd12520, RRM1_MRN1, RNA recognition motif 1 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241133 cd12689, RRM1_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240907 cd12461, RRM_SCAF4, RNA recognition motif found in SR-related and CTD-associated factor 4 (SCAF4) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240704 cd12258, RRM2_RBM26_like, RNA recognition motif 2 of vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240777 cd12331, RRM_NRD1_SEB1_like, RNA recognition motif in Saccharomyces cerevisiae protein Nrd1, Schizosaccharomyces pombe Rpb7-binding protein seb1 and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241002 cd12558, RRM3_RBM15B, RNA recognition motif 3 in putative RNA-binding protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240738 cd12292, RRM2_La_like, RNA recognition motif 2 in La autoantigen (La or SS-B or LARP3), La-related protein 7 (LARP7 or PIP7S) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241160 cd12716, RRM1_2_NP220, RNA recognition motif 1 and 2 in vertebrate nuclear protein 220 (NP220) Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240694 cd12248, RRM_RBM44, RNA recognition motif in RNA-binding protein 44 (RBM44) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241001 cd12557, RRM3_RBM15, RNA recognition motif 3 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240707 cd12261, RRM1_3_MRN1, RNA recognition motif 1 and 3 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241069 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
KOG0153|consensus377 100.0
KOG0145|consensus 360 99.82
KOG0148|consensus321 99.63
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.58
KOG0144|consensus 510 99.56
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.51
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.45
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.45
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.44
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.44
KOG0122|consensus270 99.37
PLN03120 260 nucleic acid binding protein; Provisional 99.36
KOG0149|consensus 247 99.35
KOG0145|consensus 360 99.34
KOG0107|consensus195 99.32
KOG0105|consensus 241 99.3
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.28
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.27
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.26
smart0036272 RRM_2 RNA recognition motif. 99.26
KOG0125|consensus 376 99.26
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.25
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.24
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.24
KOG0121|consensus153 99.23
KOG0117|consensus 506 99.23
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.22
KOG0144|consensus 510 99.21
PLN03121 243 nucleic acid binding protein; Provisional 99.21
PLN03213 759 repressor of silencing 3; Provisional 99.2
KOG0151|consensus 877 99.17
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.17
KOG4207|consensus 256 99.17
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.17
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.16
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.15
KOG0132|consensus 894 99.13
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.12
KOG0113|consensus 335 99.12
KOG0111|consensus 298 99.11
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.11
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.11
KOG0148|consensus 321 99.1
KOG0130|consensus170 99.08
smart0036071 RRM RNA recognition motif. 99.05
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.05
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.02
KOG0114|consensus124 99.02
KOG0109|consensus 346 98.99
KOG0147|consensus 549 98.93
KOG0117|consensus 506 98.93
KOG0131|consensus203 98.89
KOG0109|consensus 346 98.88
KOG0126|consensus219 98.87
KOG0108|consensus 435 98.85
KOG4206|consensus221 98.83
KOG0127|consensus 678 98.82
KOG0146|consensus 371 98.82
KOG0124|consensus 544 98.75
KOG0127|consensus 678 98.7
smart0036170 RRM_1 RNA recognition motif. 98.68
KOG0146|consensus371 98.66
KOG0131|consensus203 98.65
KOG0123|consensus 369 98.52
KOG1457|consensus 284 98.51
KOG0415|consensus 479 98.5
KOG4205|consensus 311 98.47
KOG0123|consensus 369 98.44
KOG0110|consensus725 98.41
KOG4212|consensus 608 98.4
KOG0110|consensus725 98.37
KOG0116|consensus419 98.36
KOG4660|consensus 549 98.3
KOG4208|consensus214 98.3
KOG0124|consensus 544 98.27
KOG1190|consensus492 98.22
KOG0106|consensus 216 98.21
KOG4205|consensus311 98.15
KOG4212|consensus608 98.13
KOG4661|consensus 940 98.12
KOG0533|consensus243 98.1
KOG2202|consensus260 98.07
KOG4454|consensus 267 98.01
KOG1548|consensus 382 98.01
KOG2135|consensus526 97.99
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.86
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.7
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.68
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.65
KOG4209|consensus231 97.58
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.52
KOG4206|consensus221 97.5
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.37
KOG0106|consensus216 97.3
KOG1457|consensus284 97.29
KOG1190|consensus492 97.27
KOG0112|consensus 975 97.22
KOG4211|consensus 510 97.07
smart0035627 ZnF_C3H1 zinc finger. 97.05
KOG0120|consensus500 96.97
KOG0147|consensus 549 96.88
KOG0226|consensus290 96.86
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 96.59
KOG0129|consensus 520 96.42
KOG1855|consensus 484 96.34
KOG1456|consensus 494 96.17
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.02
KOG0120|consensus500 95.91
KOG1456|consensus494 95.9
KOG1995|consensus 351 95.84
KOG4676|consensus 479 95.71
KOG4210|consensus285 95.7
KOG3152|consensus278 95.68
KOG4211|consensus 510 95.68
KOG1548|consensus382 95.67
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.57
KOG1365|consensus 508 95.0
KOG2193|consensus 584 94.87
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.79
KOG0129|consensus520 94.52
KOG4285|consensus350 94.41
KOG0112|consensus 975 94.3
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 94.05
KOG2314|consensus 698 93.75
KOG0115|consensus 275 93.39
KOG2416|consensus 718 93.18
KOG0105|consensus241 93.01
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 92.89
KOG4307|consensus944 92.23
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 91.44
KOG1996|consensus378 90.98
KOG4849|consensus 498 90.48
KOG2068|consensus 327 89.92
KOG0128|consensus881 89.77
KOG4574|consensus 1007 88.14
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 87.34
KOG0128|consensus881 87.33
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 85.71
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 85.08
KOG4307|consensus 944 84.96
PF1001342 DUF2256: Uncharacterized protein conserved in bact 84.38
KOG1365|consensus 508 81.43
KOG4410|consensus396 80.33
KOG0804|consensus 493 80.24
>KOG0153|consensus Back     alignment and domain information
Probab=100.00  E-value=2e-102  Score=714.21  Aligned_cols=281  Identities=67%  Similarity=1.224  Sum_probs=273.5

Q ss_pred             CCCCcccccchhhh------------------hccccCCcccccCCcceeEEecCCCCCcccchhhhhhhhcccCccccc
Q psy14139          5 KTSSTYNRQSWEDA------------------TKEKYGKECKICARPFTVFRWCPGARMRFKKTEVCQTCARLKNVCQTC   66 (327)
Q Consensus         5 ~~~~~~~~~~~e~~------------------~k~~~g~eckic~rpft~f~w~~~~~~~~kkt~ic~~ca~~kn~cq~c   66 (327)
                      .+.+|||+++||++                  ||++||+||||||||||+|||+||+++|||||+||||||++|||||||
T Consensus         4 ~~~~~~n~~~wEd~dfPiiCe~CLGdnpyvRMtK~~~gkECKICtrPfT~Frw~pgr~~r~kKTeICqtCaklKNvCQ~C   83 (377)
T KOG0153|consen    4 GPKRDYNRQNWEDADFPIICETCLGDNPYVRMTKEPYGKECKICTRPFTIFRWCPGRGARFKKTEICQTCAKLKNVCQTC   83 (377)
T ss_pred             ccccccccccccccCccHHHHHhcCCCceeeeeccccCCccceecCcceEEEeccccccccccchHHHHHHHHHhHHHHh
Confidence            34569999999997                  999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCcHHHHHHHhhhcCCCCCccccHHHHHHHHHHhhhcCCCCCCccccCCCcChHHHHHHHhhcCCCccCCCccc
Q psy14139         67 LLDLEYGLPIQVRDTALKIKDDIPKSDVNKEYYIQNMDHEIGKIDSTTPAGALGKASGSSEMLMKLARTTPYYKRNRPHI  146 (327)
Q Consensus        67 ~ldl~~~lp~~~rd~~l~~~~~~p~s~~n~ey~~~~~e~~l~~~~~~~~~~~~g~~~~~~~~l~kl~~~~p~y~r~~~~~  146 (327)
                      ||||+|||||||||++|++++.+|+|++|+|||+|++++++.++++++..++.++...++++|++|+++.|||+||++||
T Consensus        84 mLDle~glPiqvRD~~l~l~dn~p~~dvnre~f~qn~~r~l~~G~~~q~~~~~~~a~~~~d~l~~l~rt~p~ykrn~p~I  163 (377)
T KOG0153|consen   84 MLDLEYGLPIQVRDAALSLVDNVPTSDVNREYFAQNHDRKLSNGDDTQPASAKARALAPNDMLRKLQRTTPYYKRNRPHI  163 (377)
T ss_pred             hhhhccCCcceehhhhhhhhhccchhhhhHHHHHHHHHhhcccCCCcccccchhcccchHHHHHHHhccCccccCCCCcc
Confidence            99999999999999999999999999999999999999999999988777777888899999999999999999999999


Q ss_pred             cccccccccCCCCCCCCCCCCCCCCCCCCcccCccccCCCCCChhHHHHHHhhcCCCCCCCCCCCCccEEEEcCCCCCCC
Q psy14139        147 CSFWVKGECRRGEECPYRHEKPTDPDDPLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLT  226 (327)
Q Consensus       147 C~ff~kG~C~rG~~Cpy~H~~p~~~~~~l~~qni~dr~~G~~~p~~~k~~~~~~~~p~~~~p~d~~~~tLfVgnLp~~it  226 (327)
                      ||||++|+|+||++|+|+|++|  ++++++.|||+|||+|.++|++.|++.++..++.++||+|.++++||||+|.+.++
T Consensus       164 csf~v~geckRG~ec~yrhEkp--~d~~L~~qni~dryyg~ndPva~kil~ra~~~~~lepPeD~~I~tLyIg~l~d~v~  241 (377)
T KOG0153|consen  164 CSFFVKGECKRGAECPYRHEKP--PDDPLSLQNIKDRYYGLNDPVALKILNRAGSAGTLEPPEDTSIKTLYIGGLNDEVL  241 (377)
T ss_pred             ccceeeccccccccccccccCC--CCcchhhcccccccccccChHHHHHHhhcccccccCCCcccceeEEEecccccchh
Confidence            9999999999999999999999  67889999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhcCCeEEEEEecCCCeEEEEeCCHHHHHHHHHHhcCCeEECCeeEEEEeccC
Q psy14139        227 EQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRA  287 (327)
Q Consensus       227 e~~Lr~~F~~fG~I~~v~i~~~kg~aFV~F~~~~~Ae~A~~~~l~g~~i~G~~L~V~~ak~  287 (327)
                      |.+|+++|.+||+|++|++...++||||+|.++++||.|++..++.+.|+|++|+|.|+++
T Consensus       242 e~dIrdhFyqyGeirsi~~~~~~~CAFv~ftTR~aAE~Aae~~~n~lvI~G~Rl~i~Wg~~  302 (377)
T KOG0153|consen  242 EQDIRDHFYQYGEIRSIRILPRKGCAFVTFTTREAAEKAAEKSFNKLVINGFRLKIKWGRP  302 (377)
T ss_pred             HHHHHHHHhhcCCeeeEEeecccccceeeehhhHHHHHHHHhhcceeeecceEEEEEeCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999



>KOG0145|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>PF10013 DUF2256: Uncharacterized protein conserved in bacteria (DUF2256); InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4410|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
2ytc_A85 Solution Structure Of Rna Binding Domain In Pre-Mrn 3e-31
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-05
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-04
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 2e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 2e-04
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-04
3sde_A 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 3e-04
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 3e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 3e-04
3tp2_A229 Crystal Structure Of The Splicing Factor Cwc2 From 5e-04
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 5e-04
1why_A97 Solution Structure Of The Rna Recognition Motif Fro 7e-04
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 7e-04
3sde_B 261 Crystal Structure Of A Paraspeckle-Protein Heterodi 8e-04
3u1l_A240 Structure Of The Mrna Splicing Complex Component Cw 8e-04
>pdb|2YTC|A Chain A, Solution Structure Of Rna Binding Domain In Pre-Mrna- Splicing Factor Rbm22 Length = 85 Back     alignment and structure

Iteration: 1

Score = 132 bits (331), Expect = 3e-31, Method: Composition-based stats. Identities = 56/78 (71%), Positives = 68/78 (87%) Query: 209 EDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEH 268 EDKTITTLYVG LGD +TE DLR+HFYQFGEIR++T++ +QQCAFIQ+ +R AAE A E Sbjct: 8 EDKTITTLYVGGLGDTITETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEK 67 Query: 269 SFNKVILGGRRLNIKWGR 286 SFNK+I+ GRRLN+KWGR Sbjct: 68 SFNKLIVNGRRLNVKWGR 85
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3TP2|A Chain A, Crystal Structure Of The Splicing Factor Cwc2 From Yeast Length = 229 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|1WHY|A Chain A, Solution Structure Of The Rna Recognition Motif From Hypothetical Rna Binding Protein Bc052180 Length = 97 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3U1L|A Chain A, Structure Of The Mrna Splicing Complex Component Cwc2 Length = 240 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 4e-45
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-38
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-29
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-27
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-27
1x5p_A97 Negative elongation factor E; structure genomics, 1e-23
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 4e-23
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-21
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-20
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 1e-19
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-19
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-18
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-18
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-18
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 6e-18
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 9e-18
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-17
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-17
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-16
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-16
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-16
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-16
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-16
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 6e-16
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 7e-16
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 8e-16
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 8e-16
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 9e-16
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-15
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 9e-14
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-15
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-15
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-14
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-15
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-15
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 4e-15
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-15
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 6e-15
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-13
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-11
2kt5_A124 RNA and export factor-binding protein 2; chaperone 8e-15
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-15
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-15
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-14
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-14
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-14
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-14
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-14
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-14
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-12
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-14
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-14
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 5e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-14
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-14
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 7e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-12
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-13
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-13
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 5e-11
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-13
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-13
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-13
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-13
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-13
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 3e-13
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-13
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-13
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-13
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-13
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-13
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 7e-13
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 8e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-13
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-13
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 9e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-12
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-12
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-12
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-12
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-12
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-12
3q2s_C229 Cleavage and polyadenylation specificity factor S; 3e-12
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-12
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-12
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 6e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 6e-12
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-12
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-08
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 7e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-12
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-11
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 1e-11
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-08
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-11
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 4e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 4e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-09
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-11
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 6e-11
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-11
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 9e-11
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-10
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-10
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-10
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-10
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-10
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 7e-10
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 9e-10
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-09
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-09
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-09
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-09
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 4e-09
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 5e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-09
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 6e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-09
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 7e-09
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 7e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 2e-08
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-08
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-08
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-08
2div_A99 TRNA selenocysteine associated protein; structural 4e-08
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 6e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 7e-08
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-08
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-07
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-07
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-07
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 8e-07
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-06
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-05
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-05
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 7e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 9e-05
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 1e-04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 2e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 2e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 6e-04
2rhk_C72 Cleavage and polyadenylation specificity factor su 3e-04
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-04
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
 Score =  153 bits (386), Expect = 4e-45
 Identities = 40/198 (20%), Positives = 66/198 (33%), Gaps = 28/198 (14%)

Query: 117 GALGKASGSSEMLMKLARTTPYYK---RNRPHICSFWVKGECRRGEECPYRHEKPTDPDD 173
           G  G     S   ++    +   +     +   C F+ KG C  G +C Y H  P + D 
Sbjct: 40  GFAGNTRFVSPFALQPQLHSGKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDI 99

Query: 174 PLADQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDKTITTLYVGNLGDKLT------- 226
                 ++       D    +  A             K   TLYVG +   L        
Sbjct: 100 G--KLALRTEVL---DCFGREKFADYREDMGGIGSFRKKNKTLYVGGIDGALNSKHLKPA 154

Query: 227 --EQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILG-------- 276
             E  +R  F + G+I  +  +  + C F+++  +  AE A E   N+ +L         
Sbjct: 155 QIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDD 214

Query: 277 ---GRRLNIKWGRAQANR 291
              G  L +KW     + 
Sbjct: 215 RREGTGLLVKWANEDPDP 232


>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.95
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.74
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.74
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.73
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.72
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.71
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.7
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.7
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.7
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.7
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.69
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.69
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.69
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.69
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.69
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.69
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.69
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.69
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.69
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.68
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.68
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.68
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.68
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.68
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.68
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.68
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.67
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.67
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.67
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.67
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.67
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.67
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.67
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.67
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.67
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.67
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.66
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.66
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.66
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.66
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.66
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.66
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.66
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.66
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.66
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.66
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.66
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.66
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.66
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.66
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.66
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.66
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.66
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.65
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.65
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.65
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.65
1x5p_A97 Negative elongation factor E; structure genomics, 99.65
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.65
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.65
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.65
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.65
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.65
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.64
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.64
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.64
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.64
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.64
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.64
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.64
2div_A99 TRNA selenocysteine associated protein; structural 99.64
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.63
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.63
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.63
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.63
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.63
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.63
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.63
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.62
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.62
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.62
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.62
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.61
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.61
2dis_A109 Unnamed protein product; structural genomics, RRM 99.61
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.61
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.61
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.6
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.6
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.6
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.6
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.6
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.6
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.6
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.6
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.59
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.59
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.59
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.59
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.59
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.59
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.59
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.59
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.58
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.58
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.58
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.58
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.58
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.58
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.58
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.58
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.57
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.57
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.57
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.57
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.56
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.56
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.56
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.56
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.56
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.56
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.55
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.55
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.55
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.55
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.54
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.54
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.54
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.53
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.53
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.52
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.52
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.51
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.27
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.51
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.51
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.51
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.51
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.5
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.5
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.5
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.5
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.49
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.49
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.48
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.47
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.47
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.47
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.47
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.47
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.47
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.46
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.46
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.46
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.46
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.46
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.44
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.43
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.43
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.43
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.43
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.43
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.41
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.41
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.41
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.4
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.4
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.38
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.38
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.38
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.38
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.38
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.37
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.37
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.37
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.37
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.36
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.36
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.36
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.35
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.33
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.33
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.33
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.31
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.31
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.3
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.3
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.29
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.27
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.25
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.21
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.19
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.18
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.13
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.04
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.01
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.96
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.91
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.69
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.4
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.36
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.8
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.77
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.57
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.75
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 96.44
2rhk_C72 Cleavage and polyadenylation specificity factor su 95.85
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 95.72
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 95.68
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 95.67
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 95.51
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.41
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.34
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 95.02
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 94.55
2i2y_A150 Fusion protein consists of immunoglobin G- binding 94.36
2rhk_C72 Cleavage and polyadenylation specificity factor su 94.12
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 94.01
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 94.0
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 93.99
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 93.42
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 93.02
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 92.43
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 92.34
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 90.78
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 90.09
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 89.79
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 88.83
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 88.72
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 88.21
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 87.83
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 87.32
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 86.48
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 85.79
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 84.89
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 82.82
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 80.99
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 80.74
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 80.37
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
Probab=99.95  E-value=1.6e-29  Score=229.41  Aligned_cols=149  Identities=28%  Similarity=0.498  Sum_probs=114.9

Q ss_pred             hcCCCccCCCccccccccccccCCCCCCCCCCCCCCCCCCCC-c-ccCccccCCCCCChhHHHHHHhhcCCCCCCCCCCC
Q psy14139        134 RTTPYYKRNRPHICSFWVKGECRRGEECPYRHEKPTDPDDPL-A-DQNIKDRYYGVNDPVAEKLMARASTMPKLDPPEDK  211 (327)
Q Consensus       134 ~~~p~y~r~~~~~C~ff~kG~C~rG~~Cpy~H~~p~~~~~~l-~-~qni~dr~~G~~~p~~~k~~~~~~~~p~~~~p~d~  211 (327)
                      +.....+++++++|+||+||+|.+|++|+|+|++|++.+... + .+++.|.| |+     .++...+..+.+..+ .+.
T Consensus        60 g~t~~~~~~~~~~C~ffakG~C~~G~~C~y~H~lPt~~d~~~~~~~~~~~D~f-Gr-----~k~~~~~d~~~g~gs-~~~  132 (240)
T 3u1l_A           60 GKTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCF-GR-----EKFADYREDMGGIGS-FRK  132 (240)
T ss_dssp             BBCHHHHTTCCSBCHHHHTTCCSCGGGCSSBBSCCCHHHHHHHHHHCSSBCTT-SS-----BCGGGTC----------CC
T ss_pred             ccccCCcCCCCeEcCccccCCCCCCCCCCccCCCCCccchhhhcccccCcccc-cc-----hhcccchhcccCcCc-ccc
Confidence            333345678999999999999999999999999998765321 1 13455665 44     245555566665544 477


Q ss_pred             CccEEEEcCCCCCC---------CHHHHHHHHhhcCCeEEEEEecCCCeEEEEeCCHHHHHHHHHHhcCCeEE-------
Q psy14139        212 TITTLYVGNLGDKL---------TEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVIL-------  275 (327)
Q Consensus       212 ~~~tLfVgnLp~~i---------te~~Lr~~F~~fG~I~~v~i~~~kg~aFV~F~~~~~Ae~A~~~~l~g~~i-------  275 (327)
                      ..++||||||+..+         +|++|+++|++||+|.+|+|+.++|||||+|.++++|+.|+++ ++|..|       
T Consensus       133 ~~rtLfVgnL~~~~~~~~~~~~~tEe~L~~~F~~fG~I~~v~v~~~kG~AFV~F~~~~~Ae~A~~a-m~g~~l~~~~~~e  211 (240)
T 3u1l_A          133 KNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKNCGFVKFKYQANAEFAKEA-MSNQTLLLPSDKE  211 (240)
T ss_dssp             CCCEEEEECTTGGGTTCCCCHHHHHHHHHHHHHTTSCEEEEEEEGGGTEEEEEESSHHHHHHHHHH-HTTCCCCCTTSTT
T ss_pred             CCceeecCCCChhhhcccccccCcHHHHHHHHHccCCEEEEEEECCCCEEEEEeCCHHHHHHHHHH-hCCCEEecccccc
Confidence            88999999999988         7999999999999999999999999999999999999999998 588888       


Q ss_pred             -----CCeeEEEEeccCCCC
Q psy14139        276 -----GGRRLNIKWGRAQAN  290 (327)
Q Consensus       276 -----~G~~L~V~~ak~~~~  290 (327)
                           .|+.|+|+||++.+.
T Consensus       212 ~~~~~~gr~L~V~wA~~~pn  231 (240)
T 3u1l_A          212 WDDRREGTGLLVKWANEDPD  231 (240)
T ss_dssp             GGGGGGSCCCEEEECC----
T ss_pred             ccccCCCCEEEEEEccCCCC
Confidence                 899999999997654



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-17
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-17
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-16
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-14
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-14
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-14
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 6e-14
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-13
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-13
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 5e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 5e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 9e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 9e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-12
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 1e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-12
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-12
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 4e-12
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 5e-12
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 9e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 9e-12
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-11
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-11
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-11
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-11
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-10
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-10
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 4e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 5e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 6e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-09
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-09
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-09
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 8e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 1e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 2e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-08
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-08
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-08
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-07
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 4e-07
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 4e-07
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 8e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-06
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-06
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-06
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 2e-06
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 3e-06
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 5e-05
d1x4fa199 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) 9e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 0.002
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 0.002
d2cqea229 g.66.1.1 (A:429-457) Zinc finger CCCH domain-conta 0.002
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 74.6 bits (183), Expect = 1e-17
 Identities = 20/91 (21%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 208 PEDKTITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQ-------CAFIQYTSRP 260
           P+ +T + + V N+  +  ++++R+ F  FGE+++V +  K           F+ + ++ 
Sbjct: 3   PKKQTTSKILVRNIPFQANQREIRELFSTFGELKTVRLPKKMTGTGAHRGFGFVDFITKQ 62

Query: 261 AAEAAVEHSFNKVILGGRRLNIKWGRAQANR 291
            A+ A     +   L GRRL ++W  ++   
Sbjct: 63  DAKKAFNALCHSTHLYGRRLVLEWADSEVTV 93


>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.77
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.75
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.74
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.73
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.73
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.73
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.73
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.72
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.72
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.72
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.71
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.71
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.71
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.71
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.7
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.7
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.7
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.7
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.7
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.69
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.69
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.69
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.68
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.68
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.68
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.68
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.67
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.67
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.67
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.67
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.67
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.66
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.66
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.66
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.66
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.66
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.65
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.65
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.65
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.65
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.64
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.64
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.63
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.63
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.63
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.63
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.63
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.63
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.62
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.61
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.61
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.61
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.6
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.6
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.6
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.6
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.59
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.58
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.55
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.5
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.49
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.48
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.47
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.44
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.42
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.42
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.4
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.39
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.36
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.27
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.26
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.26
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.24
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.9
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.87
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.68
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.38
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.02
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 95.09
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 94.57
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 93.67
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 91.36
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 90.25
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 86.42
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 82.5
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 82.12
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nucleolysin TIAR
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=1.1e-18  Score=134.77  Aligned_cols=77  Identities=23%  Similarity=0.558  Sum_probs=73.2

Q ss_pred             ccEEEEcCCCCCCCHHHHHHHHhhcCCeEEEEEecCCCeEEEEeCCHHHHHHHHHHhcCCeEECCeeEEEEeccCCCC
Q psy14139        213 ITTLYVGNLGDKLTEQDLRDHFYQFGEIRSVTILSKQQCAFIQYTSRPAAEAAVEHSFNKVILGGRRLNIKWGRAQAN  290 (327)
Q Consensus       213 ~~tLfVgnLp~~ite~~Lr~~F~~fG~I~~v~i~~~kg~aFV~F~~~~~Ae~A~~~~l~g~~i~G~~L~V~~ak~~~~  290 (327)
                      .++|||+|||.+++|++|+++|++||+|.+|++..++|||||+|.+.++|+.|+.. ++|..++|+.|+|.|+++++.
T Consensus        18 ~~~l~v~nL~~~~te~~L~~~F~~fG~i~~v~i~~~kg~afV~f~~~~~A~~Ai~~-l~~~~i~g~~l~v~~ak~~p~   94 (96)
T d1x4ga1          18 NCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVS-VNGTTIEGHVVKCYWGKESPD   94 (96)
T ss_dssp             CCEEEEECCSSCCCHHHHHHHHHHHSCEEEEEEETTTTEEEEEESSHHHHHHHHHH-HTTCEETTEECEEECCCCCCS
T ss_pred             CCEEEEcCCCCCCCHHHHHHHHHHhCCceEEEEEecceEEEEEECCHHHHHHHHHH-hCCCEECCEEEEEEEcCCCCC
Confidence            47899999999999999999999999999999999999999999999999999998 699999999999999987654



>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure