Diaphorina citri psyllid: psy14141

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70

MFSSSSSNKETQHMNGTSMSAPHATGCVALIISALQQQGLSYSPYSIRRALEITAQYIPSVEPYAQGFGLLQVEKALEWLEKYHAELESKVRFHVTCAGSSSKNKGIHLRVGDQQVPKEVNVSVEPVFADSDNIVFDPEIKYNFQMSLSLTCSVPWVQFPNHLELMNISRQFNVKVDPSSLTPGVHNGTIFAFDSNKPEKGHVFSVEVTVVKPIVLGSNPSSKPAVSWDQVDFKANTTKHHFVLVPKEATIAVLKIRSNSLEAQGKFILHCTQHKPKLYMAVEVHKVTLTSPTMYIDSESRSLSLILIPVIFWLINSLRLNSSHLSFLTSHNTLTNQIQLSSSDSTNPTMTSSSSFSITPPIIEFPKWGLLPKKETGVLNVLSKHPEYDGRGVVIAIFDSGVDPGAAGLQVTSDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGRKLKIPTSWKNPTGDFHIGLKNVYELYPKLLQERIQKERKEKLWDPSHRKAQAEAQKNLQNFIQKHADAKNLSRENKLLKEELESMVESLNNLEKKFNCHDLGPAYDVVVFHNGDYWCACVDTTETGDLAACHVLGEYNVTRDFTSLTPADQFNFSINVYEEGNVLELVGLCSSHGTHVASIAAAYFPDEPEKNGVAPGAQIISLCIDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGRKLK

ccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccEEEEEEEccccccccEEEEccccccccCEEEEEEEEECcccccccccccCEEEEEEEEEEECcccCEEccccEEECcccEEEEEEECccccccccEEEEEEEEccccccccCEEEEEEEEEccEECcccccccccEEEEEEEECcccEEEEEEEcccccEEEEEEEEEccccccEEEEEEcccccccccccEEEEEEEEccccEEEEECcccEEEEEEEEEEEEcccccccccEEEEEEEccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHccccccccccEEEEEcccccccccccccccccccEEEEEEEccccccccccEEEEcccccEEEEccccEEEcccccccccccEEEEEEEEEEcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEECcccEEEEEEEcccccccccccccccccccccccccccccCEEEEEEEEccccEEEEEcccccccccEEcccccccccccccccccccccEEEEEEcccccCEEECcccccccccccEEEEEccccEEECccccccc

*********ET**MNGTSMSAPHATGCVALIISALQQQGLSYSPYSIRRALEITAQYIPSVEPYAQGFGLLQVEKALEWLEKYHAELESKVRFHVTCAGSSSKNKGIHLRVGDQQVPKEVNVSVEPVFADSDNIVFDPEIKYNFQMSLSLTCSVPWVQFPNHLELMNISRQFNVKVDPSSLTPGVHNGTIFAFDSNKPEKGHVFSVEVTVVKPIVLGSNPSSKPAVSWDQVDFKANTTKHHFVLVPKEATIAVLKIRSNSLEAQGKFILHCTQHKPKLYMAVEVHKVTLTSPTMYIDSESRSLSLILIPVIFWLINSLRLNSSHLSFLTSHNT************************ITPPIIEFPKWGLLPKKETGVLNVLSKHPEYDGRGVVIAIFDSGVDPGAAGLQVTSDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGRKLKIPTSWKNPTGDFHIGLKNVYELYPKLLQERIQKERKEKLWDPSHRKAQAEAQKNLQNFIQKHA*****SRENKLLKEELESMVESLNNLEKKFNCHDLGPAYDVVVFHNGDYWCACVDTTETGDLAACHVLGEYNVTRDFTSLTPADQFNFSINVYEEGNVLELVGLCSSHGTHVASIAAAYFPDEPEKNGVAPGAQIISLCIDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGR***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFSSSSSNKETQHMNGTSMSAPHATGCVALIISALQQQGLSYSPYSIRRALEITAQYIPSVEPYAQGFGLLQVEKALEWLEKYHAELESKVRFHVTCAGSSSKNKGIHLRVGDQQVPKEVNVSVEPVFADSDNIVFDPEIKYNFQMSLSLTCSVPWVQFPNHLELMNISRQFNVKVDPSSLTPGVHNGTIFAFDSNKPEKGHVFSVEVTVVKPIVLGSNPSSKPAVSWDQVDFKANTTKHHFVLVPKEATIAVLKIRSNSLEAQGKFILHCTQHKPKLYMAVEVHKVTLTSPTMYIDSESRSLSLILIPVIFWLINSLRLNSSHLSFLTSHNTLTNQIQLSSSDSTNPTMTSSSSFSITPPIIEFPKWGLLPKKETGVLNVLSKHPEYDGRGVVIAIFDSGVDPGAAGLQVTSDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGRKLKIPTSWKNPTGDFHIGLKNVYELYPKLLQERIQKERKEKLWDPSHRKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFNCHDLGPAYDVVVFHNGDYWCACVDTTETGDLAACHVLGEYNVTRDFTSLTPADQFNFSINVYEEGNVLELVGLCSSHGTHVASIAAAYFPDEPEKNGVAPGAQIISLCIDGKPKVIERYDCGGAGDVDTSTVVKVDDTNHITGLSGRKLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tripeptidyl-peptidase 2	Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited.	confident	Q64560
Tripeptidyl-peptidase 2	Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited.	confident	P29144
Tripeptidyl-peptidase 2	Component of the proteolytic cascade acting downstream of the 26S proteasome in the ubiquitin-proteasome pathway. May be able to complement the 26S proteasome function to some extent under conditions in which the latter is inhibited.	confident	A5PK39

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008240 [MF]	tripeptidyl-peptidase activity	probable	GO:0016787, GO:0017171, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0042277 [MF]	peptide binding	probable	GO:0033218, GO:0003674, GO:0005488

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LXU, chain X
Confidence level:very confident
Coverage over the Query: 373-443,463-684
View the alignment between query and template
View the model in PyMOL

Template: 3LXU, chain X
Confidence level:very confident
Coverage over the Query: 14-346
View the alignment between query and template
View the model in PyMOL