Diaphorina citri psyllid: psy1414

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-

MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM

ccHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcc

**ALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPT**DKWAM**********KKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTS****************LTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLS*******SLIQVEGLLKALQVDLSDSL**********GIRALID***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein son of sevenless	Promotes the exchange of Ras-bound GDP by GTP. Functions in signaling pathways initiated by the sevenless and epidermal growth factor receptor tyrosine kinases; implies a role for the ras pathway in neuronal development.	confident	P26675

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005657 [CC]	replication fork	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0003677 [MF]	DNA binding	probable	GO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008150 [BP]	biological_process	probable

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KSY, chain A
Confidence level:very confident
Coverage over the Query: 36-201,297-411,443-537
View the alignment between query and template
View the model in PyMOL

Template: 3KSY, chain A
Confidence level:very confident
Coverage over the Query: 222-294
View the alignment between query and template
View the model in PyMOL

Template: 1YAE, chain A
Confidence level:confident
Coverage over the Query: 13-47
View the alignment between query and template
View the model in PyMOL