Psyllid ID: psy1414

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM
ccHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcHHHHHHHHccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccEEHHEHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHEEEEHcHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEEEccccccHHccccHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHcccccHHHHHHHHc
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLcskpsphttsdvEERVrrqfptpidkwAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMfyqdehtsdsgsivhsvsettsseltYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVklippgkckeLDQMFANLMDIYEfslnfktppdplfihettsseltYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVklippgkckeLDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAkdityykcPEKLLEelknpevsiplqsdccakdityykcpEKLLEelknpevsiplqsggqGFKEAVKYYLpklflhplwhcflyFDYIRIlrglspdkedrESLIQVEGLLKALQVDLsdslqnyprngrdtGIRALIDATLRRSLSNLM
MLALKFVLSIVSrhligspwrdRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKpsphttsdveervrrqfptpidkwAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDslqnyprngrdtgirALIDATLRRSLSNLM
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHeakeaiekskkkisCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHsvsettsseltyeeIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPeklleelkNPEVSIPLQSDCCAKDITYYKCPeklleelkNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM
**ALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCS**********************DKWAM**********KKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQD********************LTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLS*******SLIQVEGLLKALQVDLSD************GIRALID***********
**ALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVH****AREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPT***************************VEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTS********************************HLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLN*******************YEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRIL*************IQVEGLLKALQVDLSDSL****************************
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKP***********VRRQFPTPIDKWAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQD****DSGSIVH*****TSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLALKFVLSIVSRHLIGSPWRDRISLAILELQEKGTIQMLYDKWWKNTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHEAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDLSDSLQNYPRNGRDTGIRALIDATLRRSLSNLM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query551 2.2.26 [Sep-21-2011]
P26675 1596 Protein son of sevenless yes N/A 0.410 0.141 0.534 8e-64
Q07889 1333 Son of sevenless homolog yes N/A 0.453 0.187 0.490 1e-56
Q62245 1319 Son of sevenless homolog yes N/A 0.453 0.189 0.478 3e-56
Q02384 1333 Son of sevenless homolog no N/A 0.404 0.167 0.529 7e-56
Q07890 1332 Son of sevenless homolog no N/A 0.402 0.166 0.525 2e-55
Q8CCK0372 Core histone macro-H2A.2 no N/A 0.148 0.220 0.280 1e-06
Q9P0M6372 Core histone macro-H2A.2 no N/A 0.148 0.220 0.280 1e-06
P22756949 Glutamate receptor ionotr no N/A 0.092 0.053 0.421 4e-06
P35061125 Histone H2A OS=Acropora f N/A N/A 0.156 0.688 0.337 4e-06
P04910131 Histone H2A-beta OS=Schiz yes N/A 0.154 0.648 0.329 4e-06
>sp|P26675|SOS_DROME Protein son of sevenless OS=Drosophila melanogaster GN=Sos PE=1 SV=2 Back     alignment and function desciption
 Score =  245 bits (625), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 125/234 (53%), Positives = 168/234 (71%), Gaps = 8/234 (3%)

Query: 51  VLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMH 110
           VL+QVHP +TA+EDA LYVE L L++LAMLC+KP PH+  DVEE+V + FP PID+WA++
Sbjct: 80  VLEQVHPRVTAKEDALLYVEKLCLRLLAMLCAKPLPHSVQDVEEKVNKSFPAPIDQWALN 139

Query: 111 EAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAG 170
           EAKE I   K+K    VLP EK+H LL KDVLQYK++ +VS ++ AVLEYISADILK+AG
Sbjct: 140 EAKEVINSKKRKS---VLPTEKVHTLLQKDVLQYKIDSSVSAFLVAVLEYISADILKMAG 196

Query: 171 NYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIV 230
           +YV  I H E+ ++DI+V M AD+VLMDM  Q E       +       ++   TYEE V
Sbjct: 197 DYVIKIAHCEITKEDIEVVMNADRVLMDMLNQSEAHILPSPLSLPAQRASA---TYEETV 253

Query: 231 HDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNF 284
            +L+ DEKQ+ RDLHMI +VF EE+VK++     +EL+ +F+N+MDIYE ++  
Sbjct: 254 KELIHDEKQYQRDLHMIIRVFREELVKIV--SDPRELEPIFSNIMDIYEVTVTL 305
Promotes the exchange of Ras-bound GDP by GTP. Functions in signaling pathways initiated by the sevenless and epidermal growth factor receptor tyrosine kinases; implies a role for the ras pathway in neuronal development.
Drosophila melanogaster (taxid: 7227)
>sp|Q07889|SOS1_HUMAN Son of sevenless homolog 1 OS=Homo sapiens GN=SOS1 PE=1 SV=1 Back     alignment and function description
>sp|Q62245|SOS1_MOUSE Son of sevenless homolog 1 OS=Mus musculus GN=Sos1 PE=1 SV=2 Back     alignment and function description
>sp|Q02384|SOS2_MOUSE Son of sevenless homolog 2 OS=Mus musculus GN=Sos2 PE=1 SV=2 Back     alignment and function description
>sp|Q07890|SOS2_HUMAN Son of sevenless homolog 2 OS=Homo sapiens GN=SOS2 PE=1 SV=2 Back     alignment and function description
>sp|Q8CCK0|H2AW_MOUSE Core histone macro-H2A.2 OS=Mus musculus GN=H2afy2 PE=1 SV=3 Back     alignment and function description
>sp|Q9P0M6|H2AW_HUMAN Core histone macro-H2A.2 OS=Homo sapiens GN=H2AFY2 PE=1 SV=3 Back     alignment and function description
>sp|P22756|GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus GN=Grik1 PE=1 SV=3 Back     alignment and function description
>sp|P35061|H2A_ACRFO Histone H2A OS=Acropora formosa PE=3 SV=2 Back     alignment and function description
>sp|P04910|H2A2_SCHPO Histone H2A-beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hta2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
170038414 1550 ras GTP exchange factor, son of sevenles 0.635 0.225 0.434 2e-84
242014971 1507 ras GTP exchange factor, son of sevenles 0.415 0.151 0.662 9e-80
157115287 1553 ras GTP exchange factor, son of sevenles 0.413 0.146 0.619 7e-76
332024491 1316 Protein son of sevenless [Acromyrmex ech 0.410 0.171 0.602 2e-72
158299946 1552 AGAP009180-PA [Anopheles gambiae str. PE 0.411 0.146 0.604 8e-72
307209796 1305 Protein son of sevenless [Harpegnathos s 0.410 0.173 0.598 2e-71
350403473 1328 PREDICTED: protein son of sevenless-like 0.410 0.170 0.594 3e-71
340722962 1344 PREDICTED: protein son of sevenless-like 0.410 0.168 0.594 3e-71
350403467 1344 PREDICTED: protein son of sevenless-like 0.410 0.168 0.594 3e-71
307176733 1286 Protein son of sevenless [Camponotus flo 0.410 0.175 0.598 3e-71
>gi|170038414|ref|XP_001847045.1| ras GTP exchange factor, son of sevenless [Culex quinquefasciatus] gi|167882088|gb|EDS45471.1| ras GTP exchange factor, son of sevenless [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  320 bits (819), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 264/469 (56%), Gaps = 119/469 (25%)

Query: 51  VLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMH 110
           VL+Q+HP+L AREDA LYVESL L++LAMLC+KP PHT  DVE+R+ R FPTPIDKWA+ 
Sbjct: 38  VLEQLHPSLQAREDALLYVESLCLRLLAMLCAKPPPHTVQDVEDRIGRTFPTPIDKWALG 97

Query: 111 EAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAG 170
           EA++ I+KSKKK    VLPV+++H LL K+VLQYK++ +VS+++ AVLEYISADILKLAG
Sbjct: 98  EARDIIDKSKKKKP--VLPVDRVHTLLQKEVLQYKIDSSVSLFLVAVLEYISADILKLAG 155

Query: 171 NYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIV 230
           NYVKNIRH+E++++DI+VAM ADK L                                  
Sbjct: 156 NYVKNIRHIEISREDIEVAMCADKYLA--------------------------------- 182

Query: 231 HDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNFKTPPDP 290
                      + +H  +   L  IV  IP  + + L  MF      Y+   +    P P
Sbjct: 183 -----------KRIHHASHERLNRIV-FIP--RTQVLMDMF------YQGDSSSSMAPSP 222

Query: 291 LFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFAN 350
           L    T  + L+YEE+V +L+ DEKQ+ RDLHMI +VF EE+VK++     KELD +F+N
Sbjct: 223 L--PPTPRTSLSYEEVVKELIHDEKQYQRDLHMIIRVFREELVKIV--RDPKELDSIFSN 278

Query: 351 LMDIYEFSCNLVGILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPE 410
           +MDIYE S  L+G LED +EM  E +   IGSC EELAEAAEFDVY++YAKDIT  +  E
Sbjct: 279 IMDIYEVSVTLLGSLEDVIEMSQEQTPPCIGSCFEELAEAAEFDVYAKYAKDITSVQAKE 338

Query: 411 KLLEELKNPEVSIPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYY 470
            L   L  PE +                                 L S G GF+EAV   
Sbjct: 339 ALANLLARPEAN--------------------------------SLMSAGHGFREAV--- 363

Query: 471 LPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEGLLKALQVDL 519
                                    +P KED+ES  QV+GLLK LQ +L
Sbjct: 364 -------------------------NPLKEDKESFEQVQGLLKPLQCEL 387

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242014971|ref|XP_002428152.1| ras GTP exchange factor, son of sevenless, putative [Pediculus humanus corporis] gi|212512695|gb|EEB15414.1| ras GTP exchange factor, son of sevenless, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157115287|ref|XP_001658182.1| ras GTP exchange factor, son of sevenless [Aedes aegypti] gi|108883505|gb|EAT47730.1| AAEL001165-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332024491|gb|EGI64689.1| Protein son of sevenless [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|158299946|ref|XP_319944.4| AGAP009180-PA [Anopheles gambiae str. PEST] gi|157013763|gb|EAA15144.4| AGAP009180-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|307209796|gb|EFN86601.1| Protein son of sevenless [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350403473|ref|XP_003486812.1| PREDICTED: protein son of sevenless-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722962|ref|XP_003399868.1| PREDICTED: protein son of sevenless-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350403467|ref|XP_003486811.1| PREDICTED: protein son of sevenless-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307176733|gb|EFN66146.1| Protein son of sevenless [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query551
UNIPROTKB|F1N8Q9 1331 SOS2 "Uncharacterized protein" 0.406 0.168 0.487 7.2e-61
UNIPROTKB|F1S4T0 928 F1S4T0 "Uncharacterized protei 0.448 0.266 0.449 5.5e-60
UNIPROTKB|F1N7C3 1333 SOS1 "Uncharacterized protein" 0.455 0.188 0.446 2.3e-59
UNIPROTKB|F1MAI3 1333 Sos2 "Protein Sos2" [Rattus no 0.410 0.169 0.476 2.3e-59
UNIPROTKB|G5E9C8 1318 SOS1 "Son of sevenless homolog 0.448 0.187 0.449 2.8e-59
UNIPROTKB|Q07889 1333 SOS1 "Son of sevenless homolog 0.448 0.185 0.449 2.9e-59
UNIPROTKB|F1Q118 1310 SOS1 "Uncharacterized protein" 0.448 0.188 0.449 3.4e-59
UNIPROTKB|Q07890 1332 SOS2 "Son of sevenless homolog 0.402 0.166 0.474 3.8e-59
MGI|MGI:98355 1333 Sos2 "son of sevenless homolog 0.404 0.167 0.478 4.8e-59
UNIPROTKB|F1P859 1304 SOS2 "Uncharacterized protein" 0.408 0.172 0.472 5.7e-59
UNIPROTKB|F1N8Q9 SOS2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 7.2e-61, Sum P(2) = 7.2e-61
 Identities = 116/238 (48%), Positives = 155/238 (65%)

Query:    49 GDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWA 108
             G V QQVHP L+A+ED+  Y+E L+L++L  LC    P T  DVEERV++ FP PIDKWA
Sbjct:    25 GQVQQQVHPNLSAKEDSLYYIEELILQLLNKLCIA-QPRTVQDVEERVQKTFPHPIDKWA 83

Query:   109 MHXXXXXXXXXXXXXXCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKL 168
             +                L+LPV+KIH LL K+VL YKV+ +VS+YI AVLEYISADILKL
Sbjct:    84 I-ADAQSAIEKRKRRNPLLLPVDKIHPLL-KEVLGYKVDYHVSLYIVAVLEYISADILKL 141

Query:   169 AGNYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSI-VHXXXXXXXXXXXXX 227
             AGNYV NIRH E++QQDIKV+M ADKVLMDMF QD    D G + +              
Sbjct:   142 AGNYVFNIRHFEISQQDIKVSMCADKVLMDMFDQD----DIGLVSLCEDEPSSSGELNYY 197

Query:   228 XIVHDLVTDEKQHLRDLHMINKVFLEEIV---KLIPPGKCKELDQMFANLMDIYEFSL 282
              +V + + +E+Q+LR+L++I KVF E  +   KL  P    ++D +F+N+ DI+E ++
Sbjct:   198 DLVRNEIAEERQYLRELNLIIKVFREAFLSNRKLFTPN---DIDVVFSNISDIHELTV 252
GO:0003677 "DNA binding" evidence=IEA
GO:0005089 "Rho guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0035023 "regulation of Rho protein signal transduction" evidence=IEA
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
UNIPROTKB|F1S4T0 F1S4T0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N7C3 SOS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAI3 Sos2 "Protein Sos2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9C8 SOS1 "Son of sevenless homolog 1 (Drosophila), isoform CRA_d" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q07889 SOS1 "Son of sevenless homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q118 SOS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q07890 SOS2 "Son of sevenless homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98355 Sos2 "son of sevenless homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P859 SOS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P26675SOS_DROMENo assigned EC number0.53410.41010.1416yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 9e-13
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 2e-12
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 5e-10
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 7e-10
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 8e-09
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 7e-08
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 9e-08
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 1e-07
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 1e-07
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 4e-07
cd00160181 cd00160, RhoGEF, Guanine nucleotide exchange facto 5e-07
smart00414106 smart00414, H2A, Histone 2A 7e-07
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 2e-06
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 3e-06
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 5e-06
smart00325180 smart00325, RhoGEF, Guanine nucleotide exchange fa 3e-05
pfam00621179 pfam00621, RhoGEF, RhoGEF domain 1e-04
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 7e-04
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information 
 Score = 66.6 bits (163), Expect = 9e-13
 Identities = 49/204 (24%), Positives = 89/204 (43%), Gaps = 39/204 (19%)

Query: 303 YEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSCNLV 362
            +E++ +L+  E+ ++RDL ++ +VFL+ + K + P   +E++ +F N+ +IYEF    +
Sbjct: 1   RQEVIKELLQTERNYVRDLKLLVEVFLKPLDKELLPLSPEEVELLFGNIEEIYEFHRIFL 60

Query: 363 GILEDNLEMCNEASNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVS 422
             LE+ +E   + S   IG    +LA    F +YS Y  +        +LL++LK  + +
Sbjct: 61  KSLEERVEE-WDKSGPRIGDVFLKLAPF--FKIYSEYCSNHPDA---LELLKKLK--KFN 112

Query: 423 IPLQSDCCAKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHC 482
              Q               + LE+ +                E  +  L  L L P+   
Sbjct: 113 KFFQ---------------EFLEKAE---------------SECGRLKLESLLLKPVQRL 142

Query: 483 FLYFDYI-RILRGLSPDKEDRESL 505
             Y   +  +L+      EDRE L
Sbjct: 143 TKYPLLLKELLKHTPDGHEDREDL 166

It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains. Length = 181
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 551
PTZ00252134 histone H2A; Provisional 99.97
PLN00154136 histone H2A; Provisional 99.97
PLN00153129 histone H2A; Provisional 99.97
PLN00157132 histone H2A; Provisional 99.97
smart00414106 H2A Histone 2A. 99.97
PTZ00017134 histone H2A; Provisional 99.97
PLN00156139 histone H2AX; Provisional 99.97
KOG1756|consensus131 99.97
KOG3518|consensus 521 99.97
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 99.96
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 99.96
KOG1757|consensus131 99.95
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.91
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 99.91
KOG3519|consensus 756 99.86
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 99.85
KOG4240|consensus 1025 99.77
KOG2996|consensus 865 99.66
KOG0689|consensus 448 99.47
PLN0015558 histone H2A; Provisional 99.46
KOG4424|consensus 623 99.44
KOG2070|consensus 661 99.4
KOG4305|consensus 1029 99.35
KOG3523|consensus 695 99.25
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.17
KOG1054|consensus897 99.08
KOG3522|consensus 925 98.99
KOG3521|consensus 846 98.99
KOG3520|consensus 1167 98.88
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 98.53
COG5422 1175 ROM1 RhoGEF, Guanine nucleotide exchange factor fo 98.24
KOG1052|consensus656 98.06
smart00325180 RhoGEF Guanine nucleotide exchange factor for Rho/ 97.98
KOG1659|consensus224 97.95
cd00160181 RhoGEF Guanine nucleotide exchange factor for Rho/ 97.9
KOG3531|consensus 1036 97.82
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 97.64
PF00621180 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho 97.4
KOG4440|consensus993 96.93
KOG1053|consensus1258 96.9
smart0080365 TAF TATA box binding protein associated factor. TA 96.75
KOG3524|consensus 850 96.73
KOG3519|consensus756 96.44
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 96.25
KOG3518|consensus521 95.89
cd0007685 H4 Histone H4, one of the four histones, along wit 95.79
PLN00035103 histone H4; Provisional 95.73
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 94.86
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 94.54
smart0041774 H4 Histone H4. 94.39
KOG3520|consensus 1167 94.35
PTZ00015102 histone H4; Provisional 94.04
KOG4424|consensus 623 93.97
KOG3523|consensus695 93.5
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 91.93
KOG1657|consensus236 90.58
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 89.16
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 86.95
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 86.93
PF0296966 TAF: TATA box binding protein associated factor (T 85.9
PLN00158116 histone H2B; Provisional 85.61
KOG4305|consensus 1029 85.55
smart00428105 H3 Histone H3. 84.36
smart0042789 H2B Histone H2B. 83.09
KOG4240|consensus1025 82.76
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 80.47
>PTZ00252 histone H2A; Provisional Back     alignment and domain information 
Probab=99.97  E-value=2.4e-32  Score=247.56  Aligned_cols=91  Identities=22%  Similarity=0.414  Sum_probs=87.5

Q ss_pred             CcccccHhHHHHhhhcCccccccccchhHHHHHHHHHHHHHHHHHHHHHHHh--cCCcccccchhhhhhcCchHHHhhhc
Q psy1414         124 SCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKN--IRHVEVAQQDIKVAMYADKVLMDMFY  201 (551)
Q Consensus       124 a~L~FPV~ri~r~Lk~~~~~~Rv~~~a~VyLaAVLEYLtaeILELAgn~a~~--~k~~rItp~hi~~Ai~~D~eL~~Lf~  201 (551)
                      |||+|||+||||+|++++|+.||+++||||||||||||++||||||||.|++  ++++||+|+||++||+||+||++||+
T Consensus        22 AGL~FPVgRi~R~Lr~g~ya~RIga~ApVYLAAVLEYLtaEVLELAgnaa~d~~~kk~RItPrHi~lAIrNDeEL~~Ll~  101 (134)
T PTZ00252         22 AGLIFPVGRVGSLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAAAQQAKKPKRLTPRTVTLAVRHDDDLGSLLK  101 (134)
T ss_pred             cCccCchHHHHHHHHcCCcccccCCccHHHHHHHHHHHHHHHHHHHHHHHHhccCCcccccHHHHHhhccChHHHHHHHc
Confidence            9999999999999999999999999999999999999999999999999976  78899999999999999999999999


Q ss_pred             CCCccccCCcccccc
Q psy1414         202 QDEHTSDSGSIVHSV  216 (551)
Q Consensus       202 ~~~~ti~~ggv~~~~  216 (551)
                      +  +||++|||+++-
T Consensus       102 ~--vTIa~GGVlP~i  114 (134)
T PTZ00252        102 N--VTLSRGGVMPSL  114 (134)
T ss_pred             C--CccCCCccCCCc
Confidence            8  899999999643

>PLN00154 histone H2A; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>KOG1756|consensus Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1757|consensus Back     alignment and domain information
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0689|consensus Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>KOG3522|consensus Back     alignment and domain information
>KOG3521|consensus Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases Back     alignment and domain information
>KOG1659|consensus Back     alignment and domain information
>cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain Back     alignment and domain information
>KOG3531|consensus Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>KOG3524|consensus Back     alignment and domain information
>KOG3519|consensus Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3518|consensus Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>KOG3520|consensus Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>KOG4424|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1657|consensus Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>KOG4305|consensus Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>KOG4240|consensus Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3ksy_A 1049 Crystal Structure Of The Histone Domain, Dh-Ph Unit 8e-49
3ksy_A 1049 Crystal Structure Of The Histone Domain, Dh-Ph Unit 2e-27
1q9c_A191 Crystal Structure Of The Histone Domain Of Son Of S 5e-41
1xdv_A 847 Experimentally Phased Structure Of Human The Son Of 6e-26
1xd4_A 852 Crystal Structure Of The Dh-Ph-Cat Module Of Son Of 7e-26
1dbh_A 354 Dbl And Pleckstrin Homology Domains From Hsos1 Leng 1e-24
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 5e-07
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 5e-07
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 5e-07
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 5e-07
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 5e-07
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 6e-07
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 7e-07
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 7e-07
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 8e-07
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 8e-07
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 9e-07
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 1e-06
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 1e-06
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 1e-06
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-06
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 2e-06
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 2e-06
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 2e-06
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 2e-06
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 2e-06
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 2e-06
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 3e-06
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 3e-06
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 3e-06
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 3e-06
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 3e-06
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 3e-06
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 3e-06
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 3e-06
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 3e-06
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 3e-06
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 3e-06
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 5e-06
2pyo_C120 Drosophila Nucleosome Core Length = 120 5e-06
2nqb_C123 Drosophila Nucleosome Structure Length = 123 5e-06
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 7e-06
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 1e-05
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 3e-05
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 3e-05
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 4e-05
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 8e-04
>pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 Back     alignment and structure 
Iteration: 1

 Score =  191 bits (485), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 159/272 (58%), Gaps = 33/272 (12%)
Query: 51  VLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMH 110
           V  QVHPTL + +DA  YVE L+L++L MLC +  P + SDVEERV++ FP PIDKWA+ 
Sbjct: 30  VQGQVHPTLESNDDALQYVEELILQLLNMLC-QAQPRSASDVEERVQKSFPHPIDKWAI- 87
Query: 111 XXXXXXXXXXXXXXCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAG 170
                          L LPVEKIH LL K+VL YK++  VS+YI AVLEYISADILKL G
Sbjct: 88  ADAQSAIEKRKRRNPLSLPVEKIHPLL-KEVLGYKIDHQVSVYIVAVLEYISADILKLVG 146
Query: 171 NYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQ-----------DEHTSDSGSIVHXXXXX 219
           NYV+NIRH E+ +QDIKVAM ADKVLMDMF+Q           DE  S SG   +     
Sbjct: 147 NYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTY----- 201
Query: 220 XXXXXXXXXIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYE 279
                    +V   + + +Q++R+L++I KVF E  V         +++ +F+ ++DI+E
Sbjct: 202 -------YDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHE 254
Query: 280 FSLNFKTPPDPLFIHETTSSELTYEEIVHDLV 311
            S+        L  H   + E+T E   H LV
Sbjct: 255 LSVK-------LLGHIEDTVEMTDEGSPHPLV 279
>pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 Back     alignment and structure
>pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 Back     alignment and structure
>pdb|1XDV|A Chain A, Experimentally Phased Structure Of Human The Son Of Sevenless Protein At 4.1 Ang. Length = 847 Back     alignment and structure
>pdb|1XD4|A Chain A, Crystal Structure Of The Dh-Ph-Cat Module Of Son Of Sevenless (Sos) Length = 852 Back     alignment and structure
>pdb|1DBH|A Chain A, Dbl And Pleckstrin Homology Domains From Hsos1 Length = 354 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query551
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 4e-71
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 3e-45
1dbh_A 354 Protein (human SOS 1); guanine nucleotide exchange 2e-31
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 2e-09
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 7e-16
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 6e-14
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 2e-07
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 5e-13
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 2e-12
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 2e-11
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 1e-06
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 9e-11
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 1e-05
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 9e-11
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 1e-10
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 2e-05
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 9e-10
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 2e-05
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 2e-09
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 2e-09
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 2e-06
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 4e-09
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 2e-04
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 6e-09
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 6e-09
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 1e-08
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 1e-08
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 1e-08
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 2e-08
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 2e-04
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 7e-08
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 1e-07
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 6e-05
1txd_A 385 RHO guanine nucleotide exchange factor 12; helical 1e-07
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 8e-05
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 3e-07
3t06_A 418 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-07
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 5e-05
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 4e-07
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 4e-05
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 5e-07
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 5e-07
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 5e-04
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 8e-07
3p6a_A 377 RHO guanine nucleotide exchange factor 1; regulati 1e-06
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 8e-05
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 3e-05
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 9e-05
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 5e-04
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
 Score =  245 bits (626), Expect = 4e-71
 Identities = 120/234 (51%), Positives = 164/234 (70%), Gaps = 4/234 (1%)

Query: 51  VLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMH 110
           V  QVHPTL + +DA  YVE L+L++L MLC    P + SDVEERV++ FP PIDKWA+ 
Sbjct: 30  VQGQVHPTLESNDDALQYVEELILQLLNMLCQ-AQPRSASDVEERVQKSFPHPIDKWAIA 88

Query: 111 EAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAG 170
           +A+ AIEK K++ + L LPVEKIH LL K+VL YK++  VS+YI AVLEYISADILKL G
Sbjct: 89  DAQSAIEKRKRR-NPLSLPVEKIHPLL-KEVLGYKIDHQVSVYIVAVLEYISADILKLVG 146

Query: 171 NYVKNIRHVEVAQQDIKVAMYADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIV 230
           NYV+NIRH E+ +QDIKVAM ADKVLMDMF+QD    +  S+      +TS E TY ++V
Sbjct: 147 NYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDE-EPSTSGEQTYYDLV 205

Query: 231 HDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANLMDIYEFSLNF 284
              + + +Q++R+L++I KVF E  V         +++ +F+ ++DI+E S+  
Sbjct: 206 KAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKL 259
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 100.0
1dbh_A 354 Protein (human SOS 1); guanine nucleotide exchange 100.0
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.98
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 99.95
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 99.95
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 99.95
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 99.95
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 99.95
2dfk_A 402 Collybistin II; DH domain, PH domain, cell cycle; 99.95
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 99.95
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 99.95
2z0q_A 346 XPLN, RHO guanine nucleotide exchange factor 3; DH 99.95
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.94
1foe_A 377 T-lymphoma invasion and metastasis inducing protei 99.94
2vrw_B 406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 99.93
1txd_A 385 RHO guanine nucleotide exchange factor 12; helical 99.93
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.93
1xcg_A 368 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.93
3p6a_A 377 RHO guanine nucleotide exchange factor 1; regulati 99.93
1kz7_A 353 Guanine nucleotide exchange factor DBS; guanine nu 99.92
3odw_A 536 RHO guanine nucleotide exchange factor 1; regulati 99.91
2rgn_B 354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 99.91
3t06_A 418 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.91
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 99.91
3mpx_A 434 FYVE, rhogef and PH domain-containing protein 5; s 99.91
3ky9_A 587 Proto-oncogene VAV; calponin homology domain, DBL 99.9
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 99.88
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.67
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.39
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.39
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 98.97
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 98.65
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 98.65
1f1e_A154 Histone fold protein; archaeal histone protein, DN 98.63
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 98.58
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 98.16
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 98.08
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 98.04
1by1_A209 Protein (PIX); RHO-GTPase exchange factor, transpo 98.01
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 97.98
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.97
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.88
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.86
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 97.77
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 97.77
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 97.76
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.74
1foe_A377 T-lymphoma invasion and metastasis inducing protei 97.73
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.71
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.68
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 97.68
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.55
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 97.54
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 97.53
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 97.38
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 97.29
3jzy_A 510 Intersectin 2; C2 domain, structural genomics cons 97.2
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 97.04
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 96.78
1f1e_A154 Histone fold protein; archaeal histone protein, DN 96.65
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 96.6
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 96.26
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 96.18
1taf_B70 TFIID TBP associated factor 62; transcription init 96.11
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 94.88
1taf_A68 TFIID TBP associated factor 42; transcription init 94.73
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 94.46
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 93.84
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 93.71
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 93.35
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 92.85
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 92.85
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 91.92
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 90.06
3r45_A156 Histone H3-like centromeric protein A; histone fol 89.33
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 89.28
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 89.04
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 88.72
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 88.37
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 88.33
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 87.03
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 83.93
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 83.19
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 81.21
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
Probab=100.00  E-value=2.4e-71  Score=647.96  Aligned_cols=396  Identities=45%  Similarity=0.729  Sum_probs=343.2

Q ss_pred             chhhhhhhhhc----ccCccccccCCCcccchhhhhhHHHHHHHHHHHHhcCCCCCCcchHHHHHHhhCCCCchhhhhHH
Q psy1414          36 TIQMLYDKWWK----NTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHE  111 (551)
Q Consensus        36 ~L~eLK~KWWk----s~Gkc~c~~~psl~aselglGlVlsliVaLLEfL~~~~~pktv~dvEerv~~tFp~pidkWal~~  111 (551)
                      .-+++..||..    +.+++++++||+++++++|+.++.++++.++.+||. |.|||++|||++|+++||+|+|+||+.+
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (1049)
T 3ksy_A           11 FSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQ-AQPRSASDVEERVQKSFPHPIDKWAIAD   89 (1049)
T ss_dssp             SCSSCCTTSSSSSHHHHHHHHHHHCTTSBCCHHHHHHHHHHHHHHHHHHHH-TCCCSHHHHHHHHHHHSCTTHHHHHHHH
T ss_pred             cchhhHHHHHHHHHHHHHHHHHHhCCCCCccHhHHHHHHHHHHHHHHHHhc-CCCccHHHHHHHHHHhCCCchHHHHHHH
Confidence            34578889873    346788999999999999999999999999999999 8999999999999999999999999999


Q ss_pred             HHHHHHhcccccCcccccHhHHHHhhhcCccccccccchhHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccchhhhhhc
Q psy1414         112 AKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMY  191 (551)
Q Consensus       112 a~~al~k~~~k~a~L~FPV~ri~r~Lk~~~~~~Rv~~~a~VyLaAVLEYLtaeILELAgn~a~~~k~~rItp~hi~~Ai~  191 (551)
                      |++++.++++| |||+||||||||+| +|+|++|||++||||||||||||+|||||||||+|+++++++|||+|+++|++
T Consensus        90 ~~~~~~~~~~~-~~l~~pv~~~~~~l-~~~~~~r~~~~~~~y~~avleyl~~~~l~la~~~~~~~~~~~i~p~~~~~ai~  167 (1049)
T 3ksy_A           90 AQSAIEKRKRR-NPLSLPVEKIHPLL-KEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMC  167 (1049)
T ss_dssp             HHHHHTTCCCS-SSCSSCHHHHHHHH-HHHHCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCBCCHHHHHHHHH
T ss_pred             HHHhhhccccc-CCccccHHHHHHHh-hcccccccCCCCcchhHHHHHHHHHHHHHHHHHHHHHcCCceecCcccccccc
Confidence            99999999999 99999999999999 99999999999999999999999999999999999999999999999999999


Q ss_pred             CchHHHhhhcCCCccccCCccccccccCCCcchhHHHHHHhHhHhHHHHHHHHHHHHHHHHHHHHhhCCCCChhhhHHHh
Q psy1414         192 ADKVLMDMFYQDEHTSDSGSIVHSVSETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMF  271 (551)
Q Consensus       192 ~D~eL~~Lf~~~~~ti~~ggv~~~~~~~~~~~~~~~~~v~~~~~~e~~~~r~l~~i~~vf~~~~~~~~~~~~~~~~~~~f  271 (551)
                      ||++|++||+++   ...+|+++...         ++                                           
T Consensus       168 ~d~eL~~l~~~d---ee~~~~lp~~~---------~~-------------------------------------------  192 (1049)
T 3ksy_A          168 ADKVLMDMFHQD---VEDINILSLTD---------EE-------------------------------------------  192 (1049)
T ss_dssp             HCSSHHHHCC----------------------------------------------------------------------
T ss_pred             CCHHHHHHHhhc---cccccCCCCcc---------cc-------------------------------------------
Confidence            999999999874   23445543210         11                                           


Q ss_pred             hhHHHHHHhhhccCCCCCCcccccCCCccccHHHHHHHHHhhHHHHHHHHhHHHHHHHHHHHhcCCCCChhHHHHhhhcH
Q psy1414         272 ANLMDIYEFSLNFKTPPDPLFIHETTSSELTYEEIVHDLVTDEKQHLRDLHMINKVFLEEIVKLIPPGKCKELDQMFANL  351 (551)
Q Consensus       272 ~ni~~i~~~~~~~~~~~d~~e~~p~~~~~~~y~evv~eli~tEr~YirdL~~Ii~~f~~~~~~~~~~~~~~~v~~iFgNI  351 (551)
                                             |..+.+++|.++|+|++.||+.|++||+.|+++|+.++.+...+++++++..|||||
T Consensus       193 -----------------------~~~~~~~~~revI~ELi~TE~~YV~~L~~l~~~y~~pL~~~~~~l~~~~~~~IF~Ni  249 (1049)
T 3ksy_A          193 -----------------------PSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRI  249 (1049)
T ss_dssp             -------------------------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHCTTTSCHHHHHHHHSSH
T ss_pred             -----------------------CcccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCccCCCHHHHHHHhcCH
Confidence                                   556678899999999999999999999999999999999876678999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhhccccCC-CcccchhhHHhhhhhccchhHHHHhhccCCCCchhHHhhhhcCCCcccccccccc
Q psy1414         352 MDIYEFSCNLVGILEDNLEMCNEA-SNVVIGSCLEELAEAAEFDVYSRYAKDITYYKCPEKLLEELKNPEVSIPLQSDCC  430 (551)
Q Consensus       352 ~dIyef~~~~L~~LEd~~e~~~~~-~~~~IG~CF~e~ae~~eFdiY~~Y~~n~~~~~~~~~l~~~~~~~~~~~~~~~dc~  430 (551)
                      ++||+|+..||.+||+++++.++. +.+.||.||+++++...|++|+.||+|++++.+.+.                   
T Consensus       250 ~~I~~~h~~fL~~Le~~~~~~~~~~~~~~IgdiFl~~~~~~~F~~Y~~Yc~ny~~~~a~~~-------------------  310 (1049)
T 3ksy_A          250 VDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDR-------------------  310 (1049)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCSSSSSCCCHHHHHHHHHTTTTSHHHHHHHHHHCTTHHHH-------------------
T ss_pred             HHHHHHHHHHHHHHHHHHhccccCCchhhHHHHHHHHHHHhhhhHHHHHHHhhccHHHHHH-------------------
Confidence            999999999999999999876542 458999999999988899999999999755555554                   


Q ss_pred             cccccccccchHHHHhhcCCccccccccccchhhhhHHhcccccchhhHHHHHhhHHHHHHHhcCCCCCchhHHHHHHHH
Q psy1414         431 AKDITYYKCPEKLLEELKNPEVSIPLQSGGQGFKEAVKYYLPKLFLHPLWHCFLYFDYIRILRGLSPDKEDRESLIQVEG  510 (551)
Q Consensus       431 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~f~~av~y~Lp~lLL~PV~hi~kY~~~l~~L~k~s~~~~D~~~l~~a~~  510 (551)
                                  +.+++.+|.+..|++..+++++.+.++.|++||++|||||.+|+++|++|+|+|++++|+++|++|+.
T Consensus       311 ------------l~~l~~~~~f~~fl~~~~~~~~~~~~l~L~s~LikPvQRI~rY~LLL~~LlK~Tp~~~D~~~L~~Al~  378 (1049)
T 3ksy_A          311 ------------FLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAIT  378 (1049)
T ss_dssp             ------------HHTTSSSTTHHHHHHHHCTTHHHHHHHTHHHHTTHHHHHHHHHHHHHHHHHHSCCCHHHHHHHHHHHH
T ss_pred             ------------HHHHhcChHHHHHHHHHHhhhhhhhcCChHHHHHHHHHHHhHHHHHHHHHHhcCCCcchHHHHHHHHH
Confidence                        45556677788888877888999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcc-CCCCCCCcCchhh-hhhhhhh
Q psy1414         511 LLKALQVDLSDSLQN-YPRNGRDTGIRAL-IDATLRR  545 (551)
Q Consensus       511 ~l~~v~~~i~~~~~~-~~~~~~~~~~~~~-~~~~~~~  545 (551)
                      .|+.++..|...|+. ++|  ++.++..+ ++..+++
T Consensus       379 ~i~~v~~~VNe~~~~~~~k--~r~~e~~~~~~~n~~k  413 (1049)
T 3ksy_A          379 ALLNVQSGMEKICSKSLAK--RRLSESACRFYSQQMK  413 (1049)
T ss_dssp             HTHHHHHHHHHHTTSTTHH--HHHHHHC---------
T ss_pred             HHHHHHHHHHHHhhhhhhh--hccchhhhhhhHHHHH
Confidence            999999999999965 888  77777666 6555544
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 551
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 2e-46
d1dbha1207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 5e-24
d1dbha1207 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H 5e-08
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 2e-15
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 2e-14
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 5e-12
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 1e-10
d1f5xa_208 a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta 2e-05
d1txda1234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 2e-09
d1txda1234 a.87.1.1 (A:766-999) Rho guanine nucleotide exchan 5e-04
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 9e-09
d2dfka1203 a.87.1.1 (A:37-239) Rho guanine nucleotide exchang 5e-06
d1foea1206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 1e-08
d1foea1206 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in 2e-04
d1by1a_209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 2e-07
d1by1a_209 a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI 6e-05
d1ki1b1210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 1e-06
d1ki1b1210 a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( 8e-04
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-06
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 4e-06
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 1e-05
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 1e-05
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 2e-05
d1kz7a1195 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse 4e-04
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 7e-05
d1ntya1184 a.87.1.1 (A:1231-1414) Triple functional domain pr 3e-04
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Histone domain of Son of sevenless protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  158 bits (400), Expect = 2e-46
 Identities = 98/151 (64%), Positives = 120/151 (79%), Gaps = 3/151 (1%)

Query: 51  VLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMH 110
           V  QVHPTL + +DA  YVE L+L++L MLC    P + SDVEERV++ FP PIDKWA+ 
Sbjct: 25  VQGQVHPTLESNDDALQYVEELILQLLNMLCQAQ-PRSASDVEERVQKSFPHPIDKWAIA 83

Query: 111 EAKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAG 170
           +A+ AIEK K++ + L LPVEKIH LL K+VL YK++  VS+YI AVLEYISADILKLAG
Sbjct: 84  DAQSAIEKRKRR-NPLSLPVEKIHPLL-KEVLGYKIDHQVSVYIVAVLEYISADILKLAG 141

Query: 171 NYVKNIRHVEVAQQDIKVAMYADKVLMDMFY 201
           NYV+NIRH E+ +QDIKVAM ADKVLMDMF+
Sbjct: 142 NYVRNIRHYEITKQDIKVAMCADKVLMDMFH 172
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query551
d1q9ca_172 Histone domain of Son of sevenless protein {Human 100.0
d1dbha1207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 100.0
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 99.98
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 99.97
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 99.94
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 99.9
d1ki1b1210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 99.9
d1by1a_209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 99.89
d1txda1234 Rho guanine nucleotide exchange factor 12 {Human ( 99.88
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 99.87
d1xcga1228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 99.86
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.15
d1dbha1207 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.88
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 98.7
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.49
d2dfka1203 Rho guanine nucleotide exchange factor 9, Collybis 98.05
d1by1a_209 beta-pix {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 97.79
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 97.63
d1f5xa_208 RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1ki1b1210 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 97.5
d1txda1234 Rho guanine nucleotide exchange factor 12 {Human ( 97.47
d1foea1206 GEF of TIAM1 (T-Lymphoma invasion and metastasis i 97.46
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 97.32
d1xcga1228 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.16
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 97.13
d1ntya1184 Triple functional domain protein TRIO {Human (Homo 97.05
d1kz7a1195 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 96.85
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 96.68
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 95.64
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 95.03
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 93.56
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 88.53
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 86.06
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 83.23
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 81.05
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Histone domain of Son of sevenless protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-39  Score=306.01  Aligned_cols=163  Identities=60%  Similarity=0.921  Sum_probs=146.6

Q ss_pred             chhhhhhhhhc----ccCccccccCCCcccchhhhhhHHHHHHHHHHHHhcCCCCCCcchHHHHHHhhCCCCchhhhhHH
Q psy1414          36 TIQMLYDKWWK----NTGDVLQQVHPTLTAREDACLYVESLVLKILAMLCSKPSPHTTSDVEERVRRQFPTPIDKWAMHE  111 (551)
Q Consensus        36 ~L~eLK~KWWk----s~Gkc~c~~~psl~aselglGlVlsliVaLLEfL~~~~~pktv~dvEerv~~tFp~pidkWal~~  111 (551)
                      .-+++..||..    ..++++.++||.++.++.+++++.+++..+++.||. +.|||+++||++++++||+|+++||+.+
T Consensus         6 ~~~~~~~~w~g~f~~~i~KVl~qvhP~l~i~~~Al~~i~~~i~~ll~~L~~-~~p~sv~dVe~~v~~~fp~~i~~~ai~~   84 (172)
T d1q9ca_           6 FSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLCQ-AQPRSASDVEERVQKSFPHPIDKWAIAD   84 (172)
T ss_dssp             TSTTTHHHHTTSSHHHHHHHHHHHCSSSBCCHHHHHHHHHHHHHHHHHHHT-TCCCSTTHHHHHHHHSSCTTHHHHHHHH
T ss_pred             cccccHHHHHHHHHHHHHHHHHHhCCCCCcCHHHHHHHHHHHHHHHHHHHc-cCCccHHHHHHHHHHhCCchHHHHHHHH
Confidence            34677788873    236788999999999999999999999999999998 7999999999999999999999999999


Q ss_pred             HHHHHHhcccccCcccccHhHHHHhhhcCccccccccchhHHHHHHHHHHHHHHHHHHHHHHHhcCCcccccchhhhhhc
Q psy1414         112 AKEAIEKSKKKISCLVLPVEKIHYLLSKDVLQYKVEMNVSIYITAVLEYISADILKLAGNYVKNIRHVEVAQQDIKVAMY  191 (551)
Q Consensus       112 a~~al~k~~~k~a~L~FPV~ri~r~Lk~~~~~~Rv~~~a~VyLaAVLEYLtaeILELAgn~a~~~k~~rItp~hi~~Ai~  191 (551)
                      |+++++++++| +||+|||+||||+||++ +++|||++|+|||+||||||++||||+|||+|+++++++|||+||++||+
T Consensus        85 a~~~~~srs~r-agL~fPV~rv~rlLk~~-~a~RVs~~A~vyLaavLEyl~aeILelAgn~a~~~krkrItp~dI~lAi~  162 (172)
T d1q9ca_          85 AQSAIEKRKRR-NPLSLPVEKIHPLLKEV-LGYKIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEITKQDIKVAMC  162 (172)
T ss_dssp             HHHHHC---------CCCHHHHHHHHHHH-HSSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSBCCHHHHHHHHH
T ss_pred             HHHHHhccccc-cCceecHHHHHHHHHhc-cccccccchHHHHHHHHHHHHHHHHHHHHHHHHHcCCceecHHHHHHHHh
Confidence            99999999999 99999999999999876 89999999999999999999999999999999999999999999999999


Q ss_pred             CchHHHhhhc
Q psy1414         192 ADKVLMDMFY  201 (551)
Q Consensus       192 ~D~eL~~Lf~  201 (551)
                      ||+||++||+
T Consensus       163 nD~eL~~Lf~  172 (172)
T d1q9ca_         163 ADKVLMDMFH  172 (172)
T ss_dssp             TCHHHHHHCC
T ss_pred             CCHHHHHhhC
Confidence            9999999985
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure