Diaphorina citri psyllid: psy14161


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MKLVHKNINDKDKSGVVALVPEESEDMWHAYNLITEGDSVRASTIRKVQSESNTGSSTSSRVRTMLTISVESIDFDTQACVLRLKGNCGNC
cCEEEECcccccccEEEEEEcccccHHHHHHHccccccEEEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEcccccEEEEEEEccc
MKL*H********SGVVALVPEESEDMWHAYNLITEGDSVRAST********************MLTISVESIDFDTQACVLRLKGNCGNC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVHKNINDKDKSGVVALVPEESEDMWHAYNLITEGDSVRASTIRKVQSESNTGSSTSSRVRTMLTISVESIDFDTQACVLRLKGNCGNC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein pelota homolog Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.confidentQ9BRX2
Protein pelota homolog Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.confidentQ5RCE3
Protein pelota Required prior to the first meiotic division for spindle formation and nuclear envelope breakdown during spermatogenesis. It is also required for normal eye patterning and for mitotic divisions in the ovary. Required for ovarian germ line stem cell self-renewal. May play a role in regulating translation. May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.confidentP48612

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MCA, chain B
Confidence level:very confident
Coverage over the Query: 8-46,67-90
View the alignment between query and template
View the model in PyMOL