Diaphorina citri psyllid: psy14164


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDHQDR
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccc
***************************************************LLRY**************************RGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVF*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDHQDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Hsp70-binding protein 1 Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins.confidentQ99P31
Hsp70-binding protein 1 Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.confidentQ9NZL4
Hsp70-binding protein 1 Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins.confidentQ6IMX7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032436 [BP]positive regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0031398 [BP]positive regulation of protein ubiquitinationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0031396, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XQR, chain A
Confidence level:very confident
Coverage over the Query: 90-306
View the alignment between query and template
View the model in PyMOL
Template: 3OPB, chain A
Confidence level:confident
Coverage over the Query: 67-349
View the alignment between query and template
View the model in PyMOL
Template: 3OQS, chain A
Confidence level:probable
Coverage over the Query: 90-335
View the alignment between query and template
View the model in PyMOL