Psyllid ID: psy14164


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDHQDR
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccc
cccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHccHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHccccc
mlnlnlggdavtrkqpirledsqaqpnlaieyapnqdiparqprqpsnlQDLLRYAVEAgsrsraqeapninraasmnEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIgaldnlsdyiCSIDYANDflkmgglpvlqpllegsdpeLRWRAAETVADIvqnnpfsqnfiIQTDFLNLLLTSIehdsnttvQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIkdspeaqslcrleplnlKFKLNFIkekhagnevYHKELEYVNSVLTEvfeedspeefdhqdr
mlnlnlggdavtrkqpirledsqaqpNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGsrsraqeapninraasmNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEvfeedspeefdhqdr
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDHQDR
*********************************************************************************RGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVF*************
***************************************************LLRY****************************FLLDALNSMM****AELEKIIKTLK***DQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIE*****TVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLN************HKELEYVNSVLTEVF*************
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVF*************
************************************D***RQPRQPSNLQDLLRYAVEAG****************MNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEED**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLNLGGDAVTRKQPIRLEDSQAQPNLAIEYAPNQDIPARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDHQDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query361 2.2.26 [Sep-21-2011]
Q99P31357 Hsp70-binding protein 1 O yes N/A 0.839 0.848 0.334 2e-34
Q6IMX7357 Hsp70-binding protein 1 O yes N/A 0.839 0.848 0.331 5e-33
Q4R588364 Hsp70-binding protein 1 O N/A N/A 0.844 0.837 0.330 8e-33
Q9NZL4362 Hsp70-binding protein 1 O yes N/A 0.842 0.839 0.331 3e-32
O43030287 Hsp70 nucleotide exchange yes N/A 0.418 0.526 0.303 9e-11
Q2U9E2216 Hsp70 nucleotide exchange yes N/A 0.487 0.814 0.286 8e-09
Q1E3S4212 Hsp70 nucleotide exchange N/A N/A 0.282 0.481 0.351 4e-08
Q4WDH3216 Hsp70 nucleotide exchange yes N/A 0.484 0.810 0.272 9e-08
A1DLW4216 Hsp70 nucleotide exchange N/A N/A 0.493 0.824 0.271 1e-07
Q32KV6462 Nucleotide exchange facto no N/A 0.387 0.303 0.297 1e-07
>sp|Q99P31|HPBP1_MOUSE Hsp70-binding protein 1 OS=Mus musculus GN=Hspbp1 PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/332 (33%), Positives = 173/332 (52%), Gaps = 29/332 (8%)

Query: 43  PRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMMVNVGAELEK 102
           PR P NLQ LL+ A+ AGS+      P+      M+E  R +L +A+++       E+E+
Sbjct: 37  PRPPRNLQGLLQMAITAGSQE-----PDPP-PEPMSEERRQWLQEAMSAAFRGQREEVEQ 90

Query: 103 IIKTLK----------------ENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVL 146
           +   L+                 +Q +++   GAL+ L+D   ++D A DF ++ G+ +L
Sbjct: 91  MKNCLRVLSQATPAMAGEAELATDQQERE---GALELLADLCENMDNAADFCQLSGMHLL 147

Query: 147 -QPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSL 205
               LE     LRWRAA+ +    QN    Q  ++    L  LL  ++ DS  TV+VK+L
Sbjct: 148 VGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDSCDTVRVKAL 207

Query: 206 YAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLL 265
           +A+SCLVRE E  L +F++ DGFSVL+R +Q + +KL +KS FL+  L   + + K  L 
Sbjct: 208 FAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLC 267

Query: 266 SMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKE 325
           SMGMV+Q+  L+  E    +  +EH+L AL SL+ D P+    CR   L L+  L    +
Sbjct: 268 SMGMVQQLVALVRTE---HSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQ 324

Query: 326 KHAGNEVYHKELEYVNSVLTEVFEEDSPEEFD 357
                E Y +ELE+   +L   F   + +  D
Sbjct: 325 LLQQREEYQEELEFCEKLLQTCFSSPTDDSMD 356




Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of target proteins.
Mus musculus (taxid: 10090)
>sp|Q6IMX7|HPBP1_RAT Hsp70-binding protein 1 OS=Rattus norvegicus GN=Hspbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R588|HPBP1_MACFA Hsp70-binding protein 1 OS=Macaca fascicularis GN=HSPBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9NZL4|HPBP1_HUMAN Hsp70-binding protein 1 OS=Homo sapiens GN=HSPBP1 PE=1 SV=1 Back     alignment and function description
>sp|O43030|FES1_SCHPO Hsp70 nucleotide exchange factor fes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fes1 PE=1 SV=1 Back     alignment and function description
>sp|Q2U9E2|FES1_ASPOR Hsp70 nucleotide exchange factor fes1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fes1 PE=3 SV=1 Back     alignment and function description
>sp|Q1E3S4|FES1_COCIM Hsp70 nucleotide exchange factor FES1 OS=Coccidioides immitis (strain RS) GN=FES1 PE=3 SV=2 Back     alignment and function description
>sp|Q4WDH3|FES1_ASPFU Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fes1 PE=3 SV=1 Back     alignment and function description
>sp|A1DLW4|FES1_NEOFI Hsp70 nucleotide exchange factor fes1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fes1 PE=3 SV=1 Back     alignment and function description
>sp|Q32KV6|SIL1_BOVIN Nucleotide exchange factor SIL1 OS=Bos taurus GN=SIL1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
242015041355 Hsp70-binding protein, putative [Pedicul 0.867 0.881 0.400 1e-50
156537283362 PREDICTED: hsp70-binding protein 1-like 0.861 0.859 0.394 3e-48
307214304325 Hsp70-binding protein 1 [Harpegnathos sa 0.761 0.846 0.404 6e-46
307189402361 Hsp70-binding protein 1 [Camponotus flor 0.783 0.783 0.362 1e-44
66554764378 PREDICTED: hsp70-binding protein 1-like 0.775 0.740 0.384 1e-44
380014402378 PREDICTED: hsp70-binding protein 1-like 0.775 0.740 0.380 2e-44
383849635378 PREDICTED: hsp70-binding protein 1-like 0.781 0.746 0.380 3e-44
91090129336 PREDICTED: similar to AGAP008392-PA [Tri 0.850 0.913 0.343 2e-43
158296710315 AGAP008392-PA [Anopheles gambiae str. PE 0.825 0.946 0.351 3e-43
189217649325 HSPA (heat shock 70kDa) binding protein, 0.831 0.923 0.378 1e-42
>gi|242015041|ref|XP_002428187.1| Hsp70-binding protein, putative [Pediculus humanus corporis] gi|212512730|gb|EEB15449.1| Hsp70-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  206 bits (524), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 196/327 (59%), Gaps = 14/327 (4%)

Query: 35  NQDIP-ARQPRQPSNLQDLLRYAVEAGSRSRAQEAPNINRAASMNEANRGFLLDALNSMM 93
           +++IP A QPR P NLQDLLRY+ EA +    +   N N   +++E +R FL +AL SM 
Sbjct: 24  SEEIPIASQPRPPRNLQDLLRYSTEAANLPGHES--NENCLQTLSEEDRKFLENALKSMT 81

Query: 94  VNVGAELEKIIKTLK-----ENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQP 148
           +++  EL K IK L+     E          ALD++ DY+ +ID ANDF K+GG  + +P
Sbjct: 82  LDIVEELLKHIKILQSANLIEGSVDSTKFEDALDSILDYVDNIDVANDFHKIGGFCIFKP 141

Query: 149 LLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAV 208
            L+     +RWR AE +A + QNNP+ QN ++++  +  LL  I+ D +  V+VK+LYA+
Sbjct: 142 CLQSIHSSIRWRGAELIAQLCQNNPYCQNKVLESKLVPTLLQMIDSDIDDLVRVKALYAI 201

Query: 209 SCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMG 268
           SCL R +EE LKEFI  DGFSVLLR +Q+  +KL IKS FL+  +C     VK  L++MG
Sbjct: 202 SCLARGSEEGLKEFIITDGFSVLLRALQTDVQKLNIKSAFLLTSICQWKPHVKDDLVNMG 261

Query: 269 MVEQMCVLIDI-----EDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFI 323
            VEQ+   I +     E+     + EHLL+AL ++++D+  AQ + R   L  K  L+FI
Sbjct: 262 YVEQLISQIAVFLQKYEEGHPPSL-EHLLNALLAIVEDNSMAQEISRTPELRFKSLLDFI 320

Query: 324 KEKHAGNEVYHKELEYVNSVLTEVFEE 350
            +     E +++E EY + + + +F E
Sbjct: 321 IKNSENKEEFNEENEYASKLSSIIFGE 347




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156537283|ref|XP_001605940.1| PREDICTED: hsp70-binding protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307214304|gb|EFN89391.1| Hsp70-binding protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307189402|gb|EFN73812.1| Hsp70-binding protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|66554764|ref|XP_393027.2| PREDICTED: hsp70-binding protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380014402|ref|XP_003691221.1| PREDICTED: hsp70-binding protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|383849635|ref|XP_003700450.1| PREDICTED: hsp70-binding protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91090129|ref|XP_971541.1| PREDICTED: similar to AGAP008392-PA [Tribolium castaneum] gi|270013498|gb|EFA09946.1| hypothetical protein TcasGA2_TC012099 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158296710|ref|XP_317058.4| AGAP008392-PA [Anopheles gambiae str. PEST] gi|157014842|gb|EAA12545.5| AGAP008392-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|189217649|ref|NP_001121272.1| HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1 [Xenopus laevis] gi|115528255|gb|AAI24887.1| LOC100158355 protein [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query361
ZFIN|ZDB-GENE-030219-55334 hspbp1 "HSPA (heat shock 70kDa 0.858 0.928 0.354 2.3e-39
RGD|628677357 Hspbp1 "HSPA binding protein, 0.850 0.859 0.345 2.4e-37
MGI|MGI:1913495357 Hspbp1 "HSPA (heat shock 70kDa 0.847 0.857 0.350 3e-37
UNIPROTKB|Q9NZL4362 HSPBP1 "Hsp70-binding protein 0.844 0.842 0.345 2.1e-36
UNIPROTKB|E2QZB3357 HSPBP1 "Uncharacterized protei 0.850 0.859 0.342 1.2e-35
UNIPROTKB|F1RMR6357 HSPBP1 "Uncharacterized protei 0.847 0.857 0.328 1.2e-35
UNIPROTKB|Q2KJ77357 HSPBP1 "HSPA (Heat shock 70kDa 0.847 0.857 0.325 2.4e-35
FB|FBgn0036306306 CG10973 [Drosophila melanogast 0.811 0.957 0.299 1.9e-26
TAIR|locus:2185113324 Fes1C "Fes1C" [Arabidopsis tha 0.631 0.703 0.278 1.6e-18
TAIR|locus:2083559363 Fes1A "Fes1A" [Arabidopsis tha 0.631 0.628 0.273 9.5e-18
ZFIN|ZDB-GENE-030219-55 hspbp1 "HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 420 (152.9 bits), Expect = 2.3e-39, P = 2.3e-39
 Identities = 117/330 (35%), Positives = 181/330 (54%)

Query:    46 PSNLQDLLRYAVEAGSRS--------RAQEAPNINRAASMNEANRGFLLDALNSM----- 92
             P NLQ +L+ AVEAGS S          QE  +  R A ++E  +G  +D +  M     
Sbjct:    11 PRNLQGVLQMAVEAGSASDGPSPLEPMTQERMDFLRGA-LSEVCKG-QMDEVEQMKRCLE 68

Query:    93 MVNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPV-LQPLLE 151
             ++      ++ ++  +E + + D    AL+ LS+   ++D A D +K+GGL + L   L 
Sbjct:    69 VLKTDGCKDREVEGEEEEEQEDDEREEALEMLSELCENLDNARDLMKLGGLDLCLSRCLC 128

Query:   152 GSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCL 211
              ++  +RWRAA+ +A   QN P  Q +++    L  LL   ++D ++TV+VK+LYAVSCL
Sbjct:   129 HTEAGIRWRAAQLIASSAQNMPEVQFYLLNQGALLTLLQLADNDPHSTVRVKALYAVSCL 188

Query:   212 VRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVE 271
             VRE E  LK+F+  DGFSVL+R +QS  EKL  KS FL+  L   + + K  +LSMGMV+
Sbjct:   189 VREQEAGLKDFLSHDGFSVLMRGMQSDSEKLRTKSAFLLLNLLNSHPEHKDTVLSMGMVQ 248

Query:   272 QMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNE 331
             Q   L+ +  +  + ++EH+L AL  L++DSP   S CR   L L+  L    +   G E
Sbjct:   249 Q---LVSVLRSPHSSVHEHVLGALCCLVEDSPRGMSDCRDPSLGLEELLKQRVQDLRGQE 305

Query:   332 VYHKELEYVNSVLTEVFEEDSPEEFDHQDR 361
                +ELE+   +    F   + E+ +  DR
Sbjct:   306 ESLEELEFCERLRAVCFPGQTQED-NAMDR 334




GO:0005575 "cellular_component" evidence=ND
RGD|628677 Hspbp1 "HSPA binding protein, cytoplasmic cochaperone 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913495 Hspbp1 "HSPA (heat shock 70kDa) binding protein, cytoplasmic cochaperone 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZL4 HSPBP1 "Hsp70-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZB3 HSPBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMR6 HSPBP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ77 HSPBP1 "HSPA (Heat shock 70kDa) binding protein, cytoplasmic cochaperone 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0036306 CG10973 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2185113 Fes1C "Fes1C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083559 Fes1A "Fes1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99P31HPBP1_MOUSENo assigned EC number0.33430.83930.8487yesN/A
Q9NZL4HPBP1_HUMANNo assigned EC number0.33130.84210.8397yesN/A
Q6IMX7HPBP1_RATNo assigned EC number0.33130.83930.8487yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 361
KOG2160|consensus342 100.0
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.97
KOG0166|consensus 514 99.88
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.86
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.83
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.8
PF0860992 Fes1: Nucleotide exchange factor Fes1; InterPro: I 99.69
KOG4224|consensus 550 99.69
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.63
KOG4224|consensus550 99.54
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.52
KOG2160|consensus342 99.34
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.33
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.3
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.19
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.16
KOG4199|consensus461 99.15
KOG4199|consensus461 99.12
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.07
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.07
KOG1293|consensus678 98.92
KOG1517|consensus 1387 98.92
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.91
KOG1048|consensus 717 98.77
KOG0168|consensus 1051 98.77
KOG1048|consensus 717 98.74
PRK09687280 putative lyase; Provisional 98.63
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.6
KOG2122|consensus 2195 98.53
KOG4500|consensus 604 98.47
PRK09687280 putative lyase; Provisional 98.46
KOG0946|consensus 970 98.45
KOG1293|consensus678 98.42
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.42
PTZ00429 746 beta-adaptin; Provisional 98.33
KOG2171|consensus 1075 98.31
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.31
KOG2122|consensus 2195 98.31
KOG0168|consensus 1051 98.27
PF05536 543 Neurochondrin: Neurochondrin 98.24
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.16
PF08045257 CDC14: Cell division control protein 14, SIN compo 98.15
KOG0946|consensus 970 98.15
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.15
KOG2171|consensus 1075 98.14
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.12
KOG4500|consensus 604 98.11
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.11
KOG2759|consensus 442 98.1
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.09
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.04
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.02
KOG3678|consensus 832 98.0
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.99
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.96
PTZ00429 746 beta-adaptin; Provisional 97.91
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.89
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 97.75
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.74
KOG4646|consensus173 97.73
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.71
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.64
KOG1062|consensus 866 97.6
KOG1517|consensus 1387 97.6
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.56
KOG2759|consensus442 97.53
KOG3678|consensus 832 97.5
COG5369 743 Uncharacterized conserved protein [Function unknow 97.49
PF05536 543 Neurochondrin: Neurochondrin 97.46
KOG4413|consensus 524 97.44
KOG1241|consensus 859 97.43
KOG1222|consensus 791 97.41
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.4
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.36
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.33
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.33
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.31
KOG4646|consensus173 97.25
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.25
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.19
COG5369743 Uncharacterized conserved protein [Function unknow 97.18
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.16
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.12
KOG2023|consensus 885 97.11
TIGR02270 410 conserved hypothetical protein. Members are found 97.08
PF05004309 IFRD: Interferon-related developmental regulator ( 97.08
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.01
TIGR02270410 conserved hypothetical protein. Members are found 97.0
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.0
KOG2259|consensus 823 96.96
KOG1061|consensus 734 96.95
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.95
KOG1059|consensus 877 96.93
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.92
KOG0213|consensus 1172 96.86
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.72
KOG1222|consensus 791 96.69
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.68
KOG2023|consensus 885 96.68
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.66
KOG1060|consensus 968 96.63
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 96.6
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.6
KOG1248|consensus 1176 96.53
COG5096 757 Vesicle coat complex, various subunits [Intracellu 96.53
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.52
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 96.51
KOG1991|consensus 1010 96.49
KOG1824|consensus 1233 96.49
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.48
KOG4535|consensus728 96.44
KOG4413|consensus 524 96.4
KOG1241|consensus 859 96.37
KOG1789|consensus 2235 96.35
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.34
KOG3036|consensus293 96.33
KOG2999|consensus 713 96.27
KOG0414|consensus 1251 96.27
COG1413335 FOG: HEAT repeat [Energy production and conversion 96.21
KOG0212|consensus 675 96.2
KOG2734|consensus 536 96.16
KOG1991|consensus 1010 96.08
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 96.05
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 96.03
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 96.02
KOG1062|consensus 866 95.91
PF04869312 Uso1_p115_head: Uso1 / p115 like vesicle tethering 95.89
KOG1059|consensus 877 95.74
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 95.71
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 95.71
KOG2734|consensus536 95.68
KOG1058|consensus 948 95.68
KOG2274|consensus 1005 95.65
KOG1789|consensus 2235 95.65
KOG2973|consensus 353 95.59
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.55
PF04869312 Uso1_p115_head: Uso1 / p115 like vesicle tethering 95.49
KOG0213|consensus1172 95.48
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 95.35
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 95.31
KOG1242|consensus569 95.29
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.25
KOG0301|consensus745 95.21
KOG1240|consensus 1431 95.17
KOG2259|consensus 823 95.17
KOG2956|consensus516 95.14
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 95.02
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 94.95
PF13251182 DUF4042: Domain of unknown function (DUF4042) 94.92
PF11701157 UNC45-central: Myosin-binding striated muscle asse 94.83
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 94.83
KOG2025|consensus 892 94.81
KOG1242|consensus 569 94.74
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 94.73
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 94.71
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 94.63
PF08167165 RIX1: rRNA processing/ribosome biogenesis 94.63
KOG1248|consensus 1176 94.63
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 94.48
cd03561133 VHS VHS domain family; The VHS domain is present i 94.47
KOG2999|consensus 713 94.42
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.36
KOG1967|consensus1030 94.24
KOG2611|consensus 698 94.21
KOG2025|consensus 892 94.13
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.11
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.11
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 94.02
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 93.99
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 93.98
KOG1240|consensus 1431 93.95
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.82
KOG2137|consensus700 93.71
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 93.61
KOG4151|consensus748 93.54
KOG1020|consensus 1692 93.41
KOG3036|consensus293 93.29
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.28
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.22
KOG1824|consensus 1233 93.16
KOG0212|consensus 675 92.95
KOG2274|consensus 1005 92.84
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 92.77
KOG1061|consensus 734 92.67
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.5
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 92.41
KOG1820|consensus 815 92.32
KOG1832|consensus 1516 92.31
KOG4151|consensus748 92.24
KOG2611|consensus 698 92.18
PF13251182 DUF4042: Domain of unknown function (DUF4042) 92.15
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 92.15
KOG1243|consensus 690 92.09
KOG1943|consensus 1133 92.03
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 91.99
KOG4653|consensus982 91.93
KOG1967|consensus1030 91.77
KOG1058|consensus 948 91.66
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 91.64
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 91.39
cd03561133 VHS VHS domain family; The VHS domain is present i 91.3
KOG1077|consensus 938 91.21
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 91.21
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 91.11
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 91.03
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 90.88
KOG2973|consensus353 90.82
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 90.81
PF05004309 IFRD: Interferon-related developmental regulator ( 90.74
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 90.56
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.52
PF1036392 DUF2435: Protein of unknown function (DUF2435) 90.48
KOG2956|consensus516 89.95
COG5116 926 RPN2 26S proteasome regulatory complex component [ 89.88
KOG0413|consensus 1529 89.38
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 89.37
KOG1077|consensus 938 89.35
COG5656 970 SXM1 Importin, protein involved in nuclear import 89.25
COG50981128 Chromosome condensation complex Condensin, subunit 89.21
KOG1060|consensus 968 89.19
COG5209315 RCD1 Uncharacterized protein involved in cell diff 89.15
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 89.13
KOG2062|consensus 929 88.99
KOG1566|consensus342 88.96
KOG4535|consensus 728 88.9
KOG2933|consensus334 88.53
KOG1020|consensus 1692 88.44
PF08216108 CTNNBL: Catenin-beta-like, Arm-motif containing nu 87.99
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 87.7
KOG2032|consensus533 87.56
PF12463303 DUF3689: Protein of unknown function (DUF3689) ; I 87.45
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 87.3
COG5116 926 RPN2 26S proteasome regulatory complex component [ 87.12
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 87.03
smart00638574 LPD_N Lipoprotein N-terminal Domain. 86.64
PF08167165 RIX1: rRNA processing/ribosome biogenesis 86.54
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 86.5
COG5098 1128 Chromosome condensation complex Condensin, subunit 86.46
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 86.31
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 86.03
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 85.75
PF12397121 U3snoRNP10: U3 small nucleolar RNA-associated prot 85.6
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 85.15
KOG2062|consensus 929 85.07
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 84.77
PF01365207 RYDR_ITPR: RIH domain; InterPro: IPR000699 Ryanodi 84.48
PF14500262 MMS19_N: Dos2-interacting transcription regulator 83.88
KOG0414|consensus 1251 83.82
KOG0567|consensus289 83.76
PF1472698 RTTN_N: Rotatin, an armadillo repeat protein, cent 83.46
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 83.17
KOG3665|consensus699 83.13
PF1036392 DUF2435: Protein of unknown function (DUF2435) 82.64
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 82.47
PLN03205652 ATR interacting protein; Provisional 82.18
COG5209315 RCD1 Uncharacterized protein involved in cell diff 81.79
KOG1943|consensus 1133 81.61
PF07814361 WAPL: Wings apart-like protein regulation of heter 81.05
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 80.49
>KOG2160|consensus Back     alignment and domain information
Probab=100.00  E-value=3.8e-41  Score=318.95  Aligned_cols=309  Identities=29%  Similarity=0.359  Sum_probs=262.0

Q ss_pred             CCCCCCCCHHHHHHHHhhcC--CCCCCCCCC------cccccCCCCHHhHHHHHHHHHhhc---CCHHHHH-------HH
Q psy14164         41 RQPRQPSNLQDLLRYAVEAG--SRSRAQEAP------NINRAASMNEANRGFLLDALNSMM---VNVGAEL-------EK  102 (361)
Q Consensus        41 ~~~~~~~~l~~LL~w~~~~s--~~~~~~~~~------~~~~~~~~s~e~~~~L~eal~~~~---~~~~~~m-------k~  102 (361)
                      +..-.|.+|+|++.|++.++  .+...+..-      +..+.. -.+|+++|+.++|...+   ++.++.|       +.
T Consensus         6 ~~~~~~~~~~gl~~ws~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~ke~~k~~~e~~~~~~e~~k~~~~~~~~~~~~~~~   84 (342)
T KOG2160|consen    6 GSHVRPPNQEGLLEWSLQLSQSLGSRPDIQISGDLGMAEAKLK-DEKEDRKWLQELMQAHTEDQKDFVEDMKVISDVMSM   84 (342)
T ss_pred             cccccCccccchhhcccccccccCCCchhhhccchhhhhhhcc-CcccchHHHHHHHHHhhhhhhhhcccchhHHHHHHh
Confidence            34668899999999999998  322211100      001111 11889999999998886   3333333       33


Q ss_pred             -HHHHHhcCCCCHHHHHHHHHHHHHhhcCcccHHHHHHCCCHHHHHHhhcCCCHHHHHHHHHHHHHHhhcCHHHHHHHHh
Q psy14164        103 -IIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQPLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQ  181 (361)
Q Consensus       103 -~l~~L~~~~~~~~~~~~Al~~L~~lve~idna~~~~~~Gg~~~Lv~LL~s~~~~vr~~Aa~~Lg~iaqnn~~~q~~v~~  181 (361)
                       ....++.++.+.++|+.||++|+++||+||||++|++.||+.+++.+|++++..||+.|+|+||+++||||.+|+.|++
T Consensus        85 ~~~~~~~~~s~~le~ke~ald~Le~lve~iDnAndl~~~ggl~~ll~~l~~~~~~lR~~Aa~Vigt~~qNNP~~Qe~v~E  164 (342)
T KOG2160|consen   85 IPIVILNSSSVDLEDKEDALDNLEELVEDIDNANDLISLGGLVPLLGYLENSDAELRELAARVIGTAVQNNPKSQEQVIE  164 (342)
T ss_pred             hhhhccCcccCCHHHHHHHHHHHHHHHHhhhhHHhHhhccCHHHHHHHhcCCcHHHHHHHHHHHHHHHhcCHHHHHHHHH
Confidence             3344455667789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cChHHHHHHhhccCCCHHHHHHHHHHHHHHhcCChhhHHHHHhhCcHHHHHHhhcc--CCHHHHHHHHHHHHHHhcCCch
Q psy14164        182 TDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQS--KKEKLVIKSCFLIACLCTDNNQ  259 (361)
Q Consensus       182 ~g~l~~Ll~LL~~~~~~~v~~~Al~ALS~l~r~~~~~~~~f~~~ggi~~Lv~lL~s--~~~~v~~kA~~ll~~L~~~~~~  259 (361)
                      .|+++.|+..|+++.+..+|++|+||||+++|++++++..|...+|+..|+.+|++  .+.++|+||++++++|+.++.+
T Consensus       165 ~~~L~~Ll~~ls~~~~~~~r~kaL~AissLIRn~~~g~~~fl~~~G~~~L~~vl~~~~~~~~lkrK~~~Ll~~Ll~~~~s  244 (342)
T KOG2160|consen  165 LGALSKLLKILSSDDPNTVRTKALFAISSLIRNNKPGQDEFLKLNGYQVLRDVLQSNNTSVKLKRKALFLLSLLLQEDKS  244 (342)
T ss_pred             cccHHHHHHHHccCCCchHHHHHHHHHHHHHhcCcHHHHHHHhcCCHHHHHHHHHcCCcchHHHHHHHHHHHHHHHhhhh
Confidence            99999999999988888999999999999999999999999999999999999998  6899999999999999999888


Q ss_pred             HHHHHHhCCcHHHHHHhccCCCCCChhHHHHHHHHHHHHHhcChHHHHhhccCcchHHHHHHHHHHhhcChhhhHHHHHH
Q psy14164        260 VKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEY  339 (361)
Q Consensus       260 ~~~~l~~~g~i~~Lv~lL~~~~~~d~~~~e~al~aL~~L~~~~~~~~~~~~~~~l~l~~~Le~~~~~l~~~~e~~~e~~~  339 (361)
                      ....+...++...+..+..+.   +.++++.++.++..++..-+... +|..+-..+.+.|+++++.+..|...+.+++|
T Consensus       245 ~~d~~~~~~f~~~~~~l~~~l---~~~~~e~~l~~~l~~l~~~~~~~-~~~~~~~~l~e~l~~~~q~~~~~~~~~~e~~l  320 (342)
T KOG2160|consen  245 DEDIASSLGFQRVLENLISSL---DFEVNEAALTALLSLLSELSTRK-ELFVSLLNLEELLKSLIQIISDHAALEEERQL  320 (342)
T ss_pred             hhhHHHHhhhhHHHHHHhhcc---chhhhHHHHHHHHHHHHHHhhcc-hhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            888888899999999999988   99999999999999987654333 45566667888899888888778788889999


Q ss_pred             HHHHHHHhcCCCCCc
Q psy14164        340 VNSVLTEVFEEDSPE  354 (361)
Q Consensus       340 ~~~il~~~f~~~~~~  354 (361)
                      +...++.||.++..+
T Consensus       321 ~~~l~~~~~e~~~~~  335 (342)
T KOG2160|consen  321 VNSLWEICGEVPSIL  335 (342)
T ss_pred             HHHHHHHhcccHHHH
Confidence            999999999877643



>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF08609 Fes1: Nucleotide exchange factor Fes1; InterPro: IPR013918 Fes1 is a cytosolic homologue of Sls1, an ER protein which has nucleotide exchange factor activity Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF04869 Uso1_p115_head: Uso1 / p115 like vesicle tethering protein, head region; InterPro: IPR006953 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associated protein (TAP) or Vesicle docking protein, this myosin-shaped molecule consists of an N-terminal globular head region, a coiled-coil tail which mediates dimerisation, and a short C-terminal acidic region [] Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF04869 Uso1_p115_head: Uso1 / p115 like vesicle tethering protein, head region; InterPro: IPR006953 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associated protein (TAP) or Vesicle docking protein, this myosin-shaped molecule consists of an N-terminal globular head region, a coiled-coil tail which mediates dimerisation, and a short C-terminal acidic region [] Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF08216 CTNNBL: Catenin-beta-like, Arm-motif containing nuclear; InterPro: IPR013180 This domain is found in eukaryotic proteins Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF12463 DUF3689: Protein of unknown function (DUF3689) ; InterPro: IPR022162 This family of proteins is found in eukaryotes Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PF12397 U3snoRNP10: U3 small nucleolar RNA-associated protein 10 ; InterPro: IPR022125 This domain family is found in eukaryotes, and is approximately 120 amino acids in length Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF01365 RYDR_ITPR: RIH domain; InterPro: IPR000699 Ryanodine and Inositol 1,4,5-trisphosphate (IP3) receptors are intracellular Ca2+-release channels Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>PF14726 RTTN_N: Rotatin, an armadillo repeat protein, centriole functioning Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>PLN03205 ATR interacting protein; Provisional Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
1xqs_A280 Crystal Structure Of The Hspbp1 Core Domain Complex 8e-31
1xqr_A296 Crystal Structure Of The Hspbp1 Core Domain Length 1e-27
1k9d_A 679 The 1.7 A Crystal Structure Of Alpha-D-Glucuronidas 5e-04
>pdb|1XQS|A Chain A, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 280 Back     alignment and structure

Iteration: 1

Score = 130 bits (328), Expect = 8e-31, Method: Compositional matrix adjust. Identities = 88/240 (36%), Positives = 134/240 (55%), Gaps = 4/240 (1%) Query: 119 GALDNLSDYICSIDYANDFLKMGGLPVL-QPLLEGSDPELRWRAAETVADIVQNNPFSQN 177 GAL+ L+D ++D A DF ++ G+ +L LE LRWRAA+ + QN Q Sbjct: 43 GALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQLIGTCSQNVAAIQE 102 Query: 178 FIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQS 237 ++ L LL ++ D+ TV+VK+L+A+SCLVRE E L +F++ DGFSVL+R +Q Sbjct: 103 QVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQ 162 Query: 238 KKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALAS 297 + +KL +KS FL+ L + + K L SMGMV+Q+ L+ E + +EH+L AL S Sbjct: 163 QVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTE---HSPFHEHVLGALCS 219 Query: 298 LIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFD 357 L+ D P+ CR L L+ L + +E Y +ELE+ +L F + + D Sbjct: 220 LVTDFPQGVRECREPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMD 279
>pdb|1XQR|A Chain A, Crystal Structure Of The Hspbp1 Core Domain Length = 296 Back     alignment and structure
>pdb|1K9D|A Chain A, The 1.7 A Crystal Structure Of Alpha-D-Glucuronidase, A Family-67 Glycoside Hydrolase From Bacillus Stearothermophilus T-1 Length = 679 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query361
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-49
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-13
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-13
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-10
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-10
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-06
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 7e-13
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 9e-13
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-10
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-12
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 7e-10
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-06
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-12
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-11
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 7e-10
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-12
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 3e-10
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-06
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 2e-04
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-11
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-10
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-09
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-06
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-10
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-05
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-05
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-04
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-05
3grl_A 651 General vesicular transport factor P115; vesicle t 6e-05
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
 Score =  166 bits (422), Expect = 3e-49
 Identities = 91/269 (33%), Positives = 140/269 (52%), Gaps = 7/269 (2%)

Query: 94  VNVGAELEKIIKTLKENQDQKDICIGALDNLSDYICSIDYANDFLKMGGL-PVLQPLLEG 152
           + V ++         E    +    GAL+ L+D   ++D A DF ++ G+  ++   LE 
Sbjct: 34  LRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEA 93

Query: 153 SDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLV 212
               LRWRAA+ +    QN    Q  ++    L  LL  ++ D+  TV+VK+L+A+SCLV
Sbjct: 94  GAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLV 153

Query: 213 RENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQ 272
           RE E  L +F++ DGFSVL+R +Q + +KL +KS FL+  L   + + K  L SMGMV+Q
Sbjct: 154 REQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQ 213

Query: 273 MCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKHAGNEV 332
           +  L+  E +     +EH+L AL SL+ D P+    CR   L L+  L    +    +E 
Sbjct: 214 LVALVRTEHS---PFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLLQQHEE 270

Query: 333 YHKELEYVNSVLTEVFEEDSPEEFDHQDR 361
           Y +ELE+   +L   F        D  DR
Sbjct: 271 YQEELEFCEKLLQTCFSS---PADDSMDR 296


>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.96
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.95
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.93
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.91
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.9
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.9
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.9
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.9
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.89
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.89
3nmz_A458 APC variant protein; protein-protein complex, arma 99.89
3nmz_A458 APC variant protein; protein-protein complex, arma 99.87
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.86
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.86
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.85
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.85
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.85
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.84
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.83
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.83
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.82
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.82
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.82
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.81
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.79
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.78
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.76
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.75
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.74
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.71
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.69
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.66
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.64
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.55
3grl_A 651 General vesicular transport factor P115; vesicle t 99.44
3grl_A 651 General vesicular transport factor P115; vesicle t 99.23
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.21
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.99
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.97
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.97
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.94
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.92
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.87
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.66
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.66
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.64
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.6
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.58
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.58
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.57
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.57
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.57
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.54
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.47
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.42
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.41
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 98.34
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.33
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.31
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.3
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.29
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.28
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 98.25
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.24
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.16
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.12
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.11
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 98.05
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.01
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.93
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.93
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.81
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.8
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.76
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.58
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.28
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.24
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.23
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.23
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.23
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 96.91
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.86
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 96.81
1ho8_A 480 Vacuolar ATP synthase subunit H; heat repeat, hydr 96.75
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 96.75
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 96.73
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.65
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 96.63
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.55
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 96.46
2x19_B 963 Importin-13; nuclear transport, protein transport; 96.2
2x1g_F 971 Cadmus; transport protein, developmental protein, 96.15
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.04
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 95.78
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.68
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 95.64
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 95.49
2x1g_F 971 Cadmus; transport protein, developmental protein, 95.47
2x19_B 963 Importin-13; nuclear transport, protein transport; 95.32
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 95.23
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.15
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.09
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 95.02
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 94.99
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 94.94
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 94.86
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.37
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 94.27
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 94.24
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 93.7
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 93.61
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 93.55
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 93.48
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 93.4
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 93.35
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 93.11
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 92.83
3pst_A425 Protein DOA1; protein degradation, CDC48, ubiquiti 92.7
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 92.68
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 92.43
3g2s_A149 C-terminal fragment of sortilin-related receptor; 92.38
3gae_A253 Protein DOA1; UFD3, CDC48, armadillo repeat, nucle 92.19
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 92.0
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 91.98
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 91.88
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 91.58
3l3f_X362 Protein DOA1, DOA1/UFD3; armadillo-like repeat str 91.2
3eg5_B 383 Protein diaphanous homolog 1; protein-protein comp 91.15
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 91.1
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.4
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 87.65
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 86.6
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 86.02
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 85.59
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 84.8
3g2s_A149 C-terminal fragment of sortilin-related receptor; 84.06
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 83.94
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 83.35
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 83.26
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 82.92
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 81.54
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 81.14
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 81.1
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-50  Score=386.16  Aligned_cols=273  Identities=33%  Similarity=0.493  Sum_probs=244.5

Q ss_pred             HHHHHHHHHhhcCCHHHHHHHHHHHHhcC----------CCCHHHHHHHHHHHHHhhcCcccHHHHHHCCCHHHHHH-hh
Q psy14164         82 RGFLLDALNSMMVNVGAELEKIIKTLKEN----------QDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQP-LL  150 (361)
Q Consensus        82 ~~~L~eal~~~~~~~~~~mk~~l~~L~~~----------~~~~~~~~~Al~~L~~lve~idna~~~~~~Gg~~~Lv~-LL  150 (361)
                      ..||.++|... +|++++||+++.+|.++          +.+.+.|+.|++.|.++++++||+++|++.||+++|+. +|
T Consensus        13 ~~~~~~~~~~~-~d~~~~mk~~l~vl~~~~~~~~~~~~~~~~~e~k~~Al~~L~~lv~~~dna~~~~~~G~l~~Lv~~lL   91 (296)
T 1xqr_A           13 LVPRGSHMRGQ-RGEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYL   91 (296)
T ss_dssp             -------CCSC-HHHHHHHHHHHHHHHSCCCSSCCHHHHHHHHHHHHHHHHHHHHHHTSHHHHHHHHHTTHHHHHHHTTT
T ss_pred             hHHHHHHHcCC-CCHHHHHHHHHHHHhCCCcccccccccCCCHHHHHHHHHHHHHHHhChhhHHHHHHcCCHHHHHHHHH
Confidence            57899988753 78999999999999997          33457999999999999999999999999999999999 99


Q ss_pred             cCCCHHHHHHHHHHHHHHhhcCHHHHHHHHhcChHHHHHHhhccCCCHHHHHHHHHHHHHHhcCChhhHHHHHhhCcHHH
Q psy14164        151 EGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSV  230 (361)
Q Consensus       151 ~s~~~~vr~~Aa~~Lg~iaqnn~~~q~~v~~~g~l~~Ll~LL~~~~~~~v~~~Al~ALS~l~r~~~~~~~~f~~~ggi~~  230 (361)
                      .++++.||..|+|+||+++++||.+|+.+++.|++|+|+++|+++++..++++|+|||||++|++++..+.|++.||++.
T Consensus        92 ~s~~~~vr~~Aa~~Lg~ia~~n~~~~~~vv~~g~l~~Ll~LL~~~~~~~v~~~A~~ALsnl~~~~~~~~~~~~~~ggi~~  171 (296)
T 1xqr_A           92 EAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSV  171 (296)
T ss_dssp             TCSSHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHHHHHCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHhCCHHHHHHHHHCCCHHHHHHHHccCCCHHHHHHHHHHHHHHHcCCcHHHHHHHHCCCHHH
Confidence            99999999999999999999999999999999999999999997667899999999999999999999999999999999


Q ss_pred             HHHhhccCCHHHHHHHHHHHHHHhcCCchHHHHHHhCCcHHHHHHhccCCCCCChhHHHHHHHHHHHHHhcChHHHHhhc
Q psy14164        231 LLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCR  310 (361)
Q Consensus       231 Lv~lL~s~~~~v~~kA~~ll~~L~~~~~~~~~~l~~~g~i~~Lv~lL~~~~~~d~~~~e~al~aL~~L~~~~~~~~~~~~  310 (361)
                      |+.+|++++.++|++|+|+|++|+.++++.+..+++.|++++|+.+|.++   +.+++++++.+|.+|+..++..+..|+
T Consensus       172 L~~lL~~~d~~v~~~A~~aLs~L~~~~~~~~~~vv~~g~i~~Lv~LL~~~---d~~v~~~al~aL~~l~~~~~~~~~~~~  248 (296)
T 1xqr_A          172 LMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTE---HSPFHEHVLGALCSLVTDFPQGVRECR  248 (296)
T ss_dssp             HHHHHHSSCHHHHHHHHHHHHHHHHHCGGGHHHHHHTTHHHHHHHHHTSC---CSTHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHcCCCHHHHHHHHHHHHHHHhCChHHHHHHHHcCCHHHHHHHHcCC---ChhHHHHHHHHHHHHHhCChhHHHHHh
Confidence            99999999999999999999999998899999999999999999999999   999999999999999999998899998


Q ss_pred             cCcchHHHHHHHHHHhhcChhhhHHHHHHHHHHHHHhcCCCCCcccCC
Q psy14164        311 LEPLNLKFKLNFIKEKHAGNEVYHKELEYVNSVLTEVFEEDSPEEFDH  358 (361)
Q Consensus       311 ~~~l~l~~~Le~~~~~l~~~~e~~~e~~~~~~il~~~f~~~~~~~~~~  358 (361)
                      .+...|..+|+++++.++.|++|+++|+||.+|+++||+++++++|||
T Consensus       249 ~~~~~l~~lL~~~~~~lq~~e~~~e~~~~~~~il~~~f~~~~~~~~~~  296 (296)
T 1xqr_A          249 EPELGLEELLRHRCQLLQQHEEYQEELEFCEKLLQTCFSSPADDSMDR  296 (296)
T ss_dssp             CGGGCHHHHHHHHHHHHTTCGGGHHHHHHHHHHHHHHCC---------
T ss_pred             ccHHHHHHHHHHHHHHccchHHHHHHHHHHHHHHHHHcCCCCCcccCC
Confidence            876678899999999999888899999999999999999999999997



>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3pst_A Protein DOA1; protein degradation, CDC48, ubiquitin, nuclear protein; 2.00A {Saccharomyces cerevisiae} PDB: 3psp_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3gae_A Protein DOA1; UFD3, CDC48, armadillo repeat, nucleus, phosphoprotein, UBL conjugation pathway, WD repeat, nuclear protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3l3f_X Protein DOA1, DOA1/UFD3; armadillo-like repeat structure, nucleus, UBL conjugation PA protein binding; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 361
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-23
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-08
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-05
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 6e-06
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 2e-05
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-05
d1gnla_ 543 e.26.1.1 (A:) Hybrid cluster protein (prismane pro 0.003
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HspBP1 domain
domain: Hsp70-binding protein 1 (HspBP1)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 96.3 bits (238), Expect = 1e-23
 Identities = 89/261 (34%), Positives = 139/261 (53%), Gaps = 14/261 (5%)

Query: 99  ELEKIIKTLK----------ENQDQKDICIGALDNLSDYICSIDYANDFLKMGGLPVL-Q 147
           +++  ++ L           E    +    GAL+ L+D   ++D A DF ++ G+ +L  
Sbjct: 6   QMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVG 65

Query: 148 PLLEGSDPELRWRAAETVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYA 207
             LE     LRWRAA+ +    QN    Q  ++    L  LL  ++ D+  TV+VK+L+A
Sbjct: 66  RYLEAGAAGLRWRAAQLIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFA 125

Query: 208 VSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLVIKSCFLIACLCTDNNQVKQVLLSM 267
           +SCLVRE E  L +F++ DGFSVL+R +Q + +KL +KS FL+  L   + + K  L SM
Sbjct: 126 ISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSM 185

Query: 268 GMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFIKEKH 327
           GMV+Q+  L+  E +     +EH+L AL SL+ D P+    CR   L L+  L    +  
Sbjct: 186 GMVQQLVALVRTEHS---PFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHRCQLL 242

Query: 328 AGNEVYHKELEYVNSVLTEVF 348
             +E Y +ELE+   +L   F
Sbjct: 243 QQHEEYQEELEFCEKLLQTCF 263


>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1gnla_ e.26.1.1 (A:) Hybrid cluster protein (prismane protein) {Desulfovibrio desulfuricans [TaxId: 876]} Length = 543 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query361
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.91
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.88
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.78
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.75
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.7
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.45
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.39
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.38
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.37
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.23
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.23
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.21
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.14
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.1
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.1
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.09
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.05
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.02
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.58
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 97.16
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.1
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.01
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.45
d1ho8a_ 477 Regulatory subunit H of the V-type ATPase {Baker's 96.42
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.17
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 94.87
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 94.83
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.41
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 94.24
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 94.23
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 94.04
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 93.32
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 92.32
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 91.76
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 91.62
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 91.11
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 88.24
d2bnxa1 343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 88.07
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 86.57
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 83.91
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 82.98
d1elka_153 Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} 80.46
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HspBP1 domain
domain: Hsp70-binding protein 1 (HspBP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.2e-38  Score=289.04  Aligned_cols=252  Identities=35%  Similarity=0.541  Sum_probs=239.1

Q ss_pred             CHHHHHHHHHHHHhcCC----------CCHHHHHHHHHHHHHhhcCcccHHHHHHCCCHHHHHH-hhcCCCHHHHHHHHH
Q psy14164         95 NVGAELEKIIKTLKENQ----------DQKDICIGALDNLSDYICSIDYANDFLKMGGLPVLQP-LLEGSDPELRWRAAE  163 (361)
Q Consensus        95 ~~~~~mk~~l~~L~~~~----------~~~~~~~~Al~~L~~lve~idna~~~~~~Gg~~~Lv~-LL~s~~~~vr~~Aa~  163 (361)
                      +|++.||+++.++.++.          .+.+.+..|++.|.+++++.||++.|+++||+++++. +|+++++++|..|++
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Al~~L~~L~~~~d~a~~l~~~gg~~~ll~~ll~s~~~~vr~~A~~   81 (264)
T d1xqra1           2 GEVEQMKSCLRVLSQPMPPTAGEAEQAADQQEREGALELLADLCENMDNAADFCQLSGMHLLVGRYLEAGAAGLRWRAAQ   81 (264)
T ss_dssp             HHHHHHHHHHHHHHSCCCSSCCHHHHHHHHHHHHHHHHHHHHHHTSHHHHHHHHHTTHHHHHHHTTTTCSSHHHHHHHHH
T ss_pred             cHHHHHHHHHHHhhccCcchHHHhhcCCCHHHHHHHHHHHHHHHcCHHHHHHHHHcCCHHHHHHHHhCCCCHHHHHHHHH
Confidence            47899999999999874          3357899999999999999999999999999999986 789999999999999


Q ss_pred             HHHHHhhcCHHHHHHHHhcChHHHHHHhhccCCCHHHHHHHHHHHHHHhcCChhhHHHHHhhCcHHHHHHhhccCCHHHH
Q psy14164        164 TVADIVQNNPFSQNFIIQTDFLNLLLTSIEHDSNTTVQVKSLYAVSCLVRENEECLKEFIKRDGFSVLLRCIQSKKEKLV  243 (361)
Q Consensus       164 ~Lg~iaqnn~~~q~~v~~~g~l~~Ll~LL~~~~~~~v~~~Al~ALS~l~r~~~~~~~~f~~~ggi~~Lv~lL~s~~~~v~  243 (361)
                      +|++++++||.+|..+++.|++|+|+++|.++.++.++.+|++||++++++++.....|+..||++.|+++|++++.+++
T Consensus        82 ~L~~l~~~~~~~~~~~~~~~~i~~Lv~lL~~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~~gi~~L~~lL~~~~~~~~  161 (264)
T d1xqra1          82 LIGTCSQNVAAIQEQVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVLMRAMQQQVQKLK  161 (264)
T ss_dssp             HHHHHHTTCHHHHHHHHHTTHHHHHHHHHHHCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHHHHSSCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHcCchHHHHHHhhcCCCHHHHHHHHHHHHHHhccchhhHHHHHHhhhhhHHHHHHhcCchHHH
Confidence            99999999999999999999999999999877788999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCchHHHHHHhCCcHHHHHHhccCCCCCChhHHHHHHHHHHHHHhcChHHHHhhccCcchHHHHHHHH
Q psy14164        244 IKSCFLIACLCTDNNQVKQVLLSMGMVEQMCVLIDIEDALDTEMNEHLLSALASLIKDSPEAQSLCRLEPLNLKFKLNFI  323 (361)
Q Consensus       244 ~kA~~ll~~L~~~~~~~~~~l~~~g~i~~Lv~lL~~~~~~d~~~~e~al~aL~~L~~~~~~~~~~~~~~~l~l~~~Le~~  323 (361)
                      .+++++|.+|+.++++.+..+.+.|+++.|+.+|+++   +.+++++++.+|.+|+..++.....+....+.+...|+.+
T Consensus       162 ~~a~~~L~~l~~~~~~~~~~~~~~~~v~~L~~lL~~~---~~~~~~~a~~aL~~L~~~~~~~~~~~~~~~l~~~~~L~~~  238 (264)
T d1xqra1         162 VKSAFLLQNLLVGHPEHKGTLCSMGMVQQLVALVRTE---HSPFHEHVLGALCSLVTDFPQGVRECREPELGLEELLRHR  238 (264)
T ss_dssp             HHHHHHHHHHHHHCGGGHHHHHHTTHHHHHHHHHTSC---CSTHHHHHHHHHHHHHTTCHHHHHHHHCGGGCHHHHHHHH
T ss_pred             HHHHHHHHHHHhccHHHHHHHHHhhhHHHHHHHHcCC---CHHHHHHHHHHHHHHHhcCHHHHHHHHHhhhhHHHHHHHH
Confidence            9999999999998999999999999999999999998   9999999999999999999999999988888888999999


Q ss_pred             HHhhcChhhhHHHHHHHHHHHHHhcC
Q psy14164        324 KEKHAGNEVYHKELEYVNSVLTEVFE  349 (361)
Q Consensus       324 ~~~l~~~~e~~~e~~~~~~il~~~f~  349 (361)
                      .+.+...+++.++.+++.+|+++||+
T Consensus       239 ~~~~~~~~~~~e~~~~~~~ll~~~~~  264 (264)
T d1xqra1         239 CQLLQQHEEYQEELEFCEKLLQTCFS  264 (264)
T ss_dssp             HHHHTTCGGGHHHHHHHHHHHHHHCC
T ss_pred             HHhccchHHHHHHHHHHHHHHHHhcC
Confidence            88888888999999999999999995



>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1elka_ a.118.9.2 (A:) Tom1 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure