Diaphorina citri psyllid: psy14166

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MRAGIIPSKALQERKILHERSLMENGDTNSNPSLGPCGPRLDAACIPLVKIADTVYSSPSKAKSPTGLSCSAAVKTKKIIYDLAETDDFDREEIPTYEEVAKLYPMETLRRPVVLIGPSGVGRSELKRRLIALDPDKFTQVTPYTTRPKKPGEEDGKEYHFVSHETMTSLISAGKMIEFGEYKGHLYGTSSDSVLELVNSGRVAVLNPAYQSLKVLRSPAFKPLVLFIAPPPFAALKESRITAFARSPFDQYNSRAFTLLWDLW
ccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHHcccccccccccEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccEEEEcHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHccccEEEEccHHHHHHHcccccccEEEEEccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHc
MRAGIIPSKALQERKILHERS*************************PLV*IADTVY*****************VKTKKIIYDLAETDDFDREEIPTYEEVAKLYPMETLRRPVVLIGPSGVGRSELKRRLIALDPDKFTQVTPYTTRPK***EEDGKEYHFVSHETMTSLISAGKMIEFGEYKGHLYGTSSDSVLELVNSGRVAVLNPAYQSLKVLRSPAFKPLVLFIAPPPFAALKESRITA****PFDQYNSRAFTLLWDLW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAGIIPSKALQERKILHERSLMENGDTNSNPSLGPCGPRLDAACIPLVKIADTVYSSPSKAKSPTGLSCSAAVKTKKIIYDLAETDDFDREEIPTYEEVAKLYPMETLRRPVVLIGPSGVGRSELKRRLIALDPDKFTQVTPYTTRPKKPGEEDGKEYHFVSHETMTSLISAGKMIEFGEYKGHLYGTSSDSVLELVNSGRVAVLNPAYQSLKVLRSPAFKPLVLFIAPPPFAALKESRITAFARSPFDQYNSRAFTLLWDLW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0031226 [CC]intrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0071212 [CC]subsynaptic reticulumprobableGO:0030424, GO:0043229, GO:0045202, GO:0043227, GO:0043226, GO:0005737, GO:0044306, GO:0043679, GO:0097458, GO:0044456, GO:0043005, GO:0061174, GO:0042995, GO:0043195, GO:0043231, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0033267, GO:0044424
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044448 [CC]cell cortex partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043269 [BP]regulation of ion transportprobableGO:0008150, GO:0051049, GO:0032879, GO:0065007, GO:0050789
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0042734 [CC]presynaptic membraneprobableGO:0097060, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NEY, chain A
Confidence level:very confident
Coverage over the Query: 109-234
View the alignment between query and template
View the model in PyMOL
Template: 1KJW, chain A
Confidence level:very confident
Coverage over the Query: 88-239
View the alignment between query and template
View the model in PyMOL