Diaphorina citri psyllid: psy14169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MSEFLSDTAQRIIVLSIVHRRVLHRFHRFCLWLGVPLHRVPLTKPQDLARIISEFALEYRTTRERVIQTREKKASHRERNKTRGKMITECEELSERD
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHccccccccc
*SEFLSDTAQRIIVLSIVHRRVLHRFHRFCLWLGVPLHRVPLTKPQDLARIISEFALEYRTTRE*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEFLSDTAQRIIVLSIVHRRVLHRFHRFCLWLGVPLHRVPLTKPQDLARIISEFALEYRTTRERVIQTREKKASHRERNKTRGKMITECEELSERD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
FH1/FH2 domain-containing protein 3 Actin-organizing protein that may cause stress fiber formation together with cell elongation.confidentQ2V2M9
FH1/FH2 domain-containing protein 3 Actin-organizing protein that may cause stress fiber formation together with cell elongation.confidentQ76LL6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0030837 [BP]negative regulation of actin filament polymerizationprobableGO:0033043, GO:0051129, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0030833, GO:0071840, GO:0051494, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0065008, GO:0031333, GO:0032970, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0010639, GO:0044087, GO:0032535, GO:0008150, GO:0009987, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UX5, chain A
Confidence level:confident
Coverage over the Query: 1-79
View the alignment between query and template
View the model in PyMOL