Diaphorina citri psyllid: psy14180


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
cccccccccccccccccccCEEccccccccCEEEEcccccEEEEccccEEEEECcccccEEEEccccccEEEcEEEEEEcccccccccCEEccEECcEEEEEEEEcccccccHHHHccccccEEEEEEEcc
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbonic anhydrase 13 Reversible hydration of carbon dioxide.confidentQ8N1Q1
Carbonic anhydrase Reversible hydration of carbon dioxide.confidentQ92051
Carbonic anhydrase 13 Reversible hydration of carbon dioxide.confidentQ9D6N1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046658 [CC]anchored to plasma membraneprobableGO:0031226, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224, GO:0031225
GO:0016151 [MF]nickel cation bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006730 [BP]one-carbon metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0044281, GO:0008152
GO:0042539 [BP]hypotonic salinity responseprobableGO:0009628, GO:0050896, GO:0008150, GO:0006950, GO:0006970, GO:0006971, GO:0009651
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0004089 [MF]carbonate dehydratase activityprobableGO:0016835, GO:0016836, GO:0003674, GO:0016829, GO:0003824
GO:0015701 [BP]bicarbonate transportprobableGO:0006811, GO:0006810, GO:0015711, GO:0044765, GO:0006820, GO:0008150, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FOY, chain A
Confidence level:very confident
Coverage over the Query: 2-131
View the alignment between query and template
View the model in PyMOL