Psyllid ID: psy14180


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
cccccccccccccccccccEEEccccccccEEEEEcccccEEEEccccEEEEEEcccccEEEEccccccEEEcEEEEEEcccccccccEEEccEEEcEEEEEEEEcccccccHHHHHcccccEEEEEEEcc
ccccccccccccEEEEccccEEcccccccccEEEEcccccEEEEcccEEEEEcccccccEEEEccccccEEEEEEEEEEccccccccccEEccEEccEEEEEEEEcccccccHHHHccccccEEEEEEEEE
mfpeasgerqspvnvdttkvssdktleekpltwkynpdktktitnpgycwrvdvdgedseltggplhhkyrleqfhchwgcvsnkgsehtvdgkayaGELHLVHwnsdkystfgeaagqpdgLAVLGVLLE
mfpeasgerqspvnvdttkvssdktleekpltwkynpdktktitnpgycwRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
*******************************TWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVL**
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
**************************EEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q8N1Q1 262 Carbonic anhydrase 13 OS= yes N/A 0.984 0.492 0.533 1e-34
Q9D6N1 262 Carbonic anhydrase 13 OS= yes N/A 0.984 0.492 0.533 3e-34
Q8UWA5 260 Carbonic anhydrase 2 OS=T N/A N/A 0.969 0.488 0.560 5e-34
P43166 264 Carbonic anhydrase 7 OS=H no N/A 0.984 0.488 0.518 2e-32
Q8HY33 262 Carbonic anhydrase 1 OS=M no N/A 0.984 0.492 0.466 3e-32
P13634 261 Carbonic anhydrase 1 OS=M no N/A 0.984 0.494 0.511 4e-32
Q1LZA1 261 Carbonic anhydrase 1 OS=B no N/A 0.984 0.494 0.488 9e-32
Q7M316 261 Carbonic anhydrase 1 OS=G N/A N/A 0.984 0.494 0.503 1e-31
Q9ERQ8 264 Carbonic anhydrase 7 OS=M no N/A 0.984 0.488 0.503 1e-31
B0BNN3 261 Carbonic anhydrase 1 OS=R no N/A 0.984 0.494 0.496 2e-31
>sp|Q8N1Q1|CAH13_HUMAN Carbonic anhydrase 13 OS=Homo sapiens GN=CA13 PE=1 SV=1 Back     alignment and function desciption
 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (67%), Gaps = 4/133 (3%)

Query: 1   MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGED-- 58
            FP A G++QSP+ + T +V  D +L  +PL+ KY+P   K I+N G+ + VD D  +  
Sbjct: 20  FFPIADGDQQSPIEIKTKEVKYDSSL--RPLSIKYDPSSAKIISNSGHSFNVDFDDTENK 77

Query: 59  SELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAG 118
           S L GGPL   YRL Q H HWG   + GSEH VDG +YA ELH+VHWNSDKY +F EAA 
Sbjct: 78  SVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAH 137

Query: 119 QPDGLAVLGVLLE 131
           +PDGLAVLGV L+
Sbjct: 138 EPDGLAVLGVFLQ 150




Reversible hydration of carbon dioxide.
Homo sapiens (taxid: 9606)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|Q9D6N1|CAH13_MOUSE Carbonic anhydrase 13 OS=Mus musculus GN=Ca13 PE=1 SV=1 Back     alignment and function description
>sp|Q8UWA5|CAH2_TRIHK Carbonic anhydrase 2 OS=Tribolodon hakonensis GN=ca2 PE=2 SV=3 Back     alignment and function description
>sp|P43166|CAH7_HUMAN Carbonic anhydrase 7 OS=Homo sapiens GN=CA7 PE=1 SV=1 Back     alignment and function description
>sp|Q8HY33|CAH1_MONDO Carbonic anhydrase 1 OS=Monodelphis domestica GN=CA1 PE=2 SV=1 Back     alignment and function description
>sp|P13634|CAH1_MOUSE Carbonic anhydrase 1 OS=Mus musculus GN=Ca1 PE=2 SV=4 Back     alignment and function description
>sp|Q1LZA1|CAH1_BOVIN Carbonic anhydrase 1 OS=Bos taurus GN=CA1 PE=2 SV=3 Back     alignment and function description
>sp|Q7M316|CAH1_GORGO Carbonic anhydrase 1 OS=Gorilla gorilla gorilla GN=CA1 PE=3 SV=3 Back     alignment and function description
>sp|Q9ERQ8|CAH7_MOUSE Carbonic anhydrase 7 OS=Mus musculus GN=Ca7 PE=1 SV=2 Back     alignment and function description
>sp|B0BNN3|CAH1_RAT Carbonic anhydrase 1 OS=Rattus norvegicus GN=Ca1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
312378087 967 hypothetical protein AND_10443 [Anophele 1.0 0.135 0.636 5e-48
99082886 276 putative cytoplasmic carbonic anhydrase 1.0 0.474 0.628 7e-46
195438258 270 GK24229 [Drosophila willistoni] gi|19416 0.992 0.481 0.656 2e-45
170031213 278 carbonic anhydrase [Culex quinquefasciat 1.0 0.471 0.628 4e-45
307209854 292 Carbonic anhydrase 2 [Harpegnathos salta 0.992 0.445 0.643 6e-45
194860429 270 GG23881 [Drosophila erecta] gi|190661448 0.992 0.481 0.641 9e-45
195397692 270 GJ18144 [Drosophila virilis] gi|19414111 0.992 0.481 0.641 1e-44
194761138 270 GF14257 [Drosophila ananassae] gi|190616 0.992 0.481 0.641 1e-44
195472701 270 GE18682 [Drosophila yakuba] gi|194174739 0.992 0.481 0.641 1e-44
195031434 270 GH11114 [Drosophila grimshawi] gi|193904 0.992 0.481 0.641 1e-44
>gi|312378087|gb|EFR24754.1| hypothetical protein AND_10443 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 84/132 (63%), Positives = 108/132 (81%), Gaps = 1/132 (0%)

Query: 1   MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSE 60
           MFP+A G+RQSPV++ T+K      L++KPL WKY P+ T+++ NPGYCWRVDV+G+ S 
Sbjct: 89  MFPQARGQRQSPVDIVTSKTQQSGDLQQKPLQWKYVPENTRSLVNPGYCWRVDVNGKGSL 148

Query: 61  LTGGPLHH-KYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQ 119
           LTGGPL++ ++ LEQFHCHWGC  ++GSEHTVDG+++AGELHLVHWN  KY +F EAAG 
Sbjct: 149 LTGGPLNNEQFILEQFHCHWGCSDSRGSEHTVDGESFAGELHLVHWNQSKYKSFAEAAGH 208

Query: 120 PDGLAVLGVLLE 131
           PDGLAVLGV L+
Sbjct: 209 PDGLAVLGVFLK 220




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|99082886|gb|ABF66618.1| putative cytoplasmic carbonic anhydrase [Anopheles gambiae] Back     alignment and taxonomy information
>gi|195438258|ref|XP_002067054.1| GK24229 [Drosophila willistoni] gi|194163139|gb|EDW78040.1| GK24229 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|170031213|ref|XP_001843481.1| carbonic anhydrase [Culex quinquefasciatus] gi|167869257|gb|EDS32640.1| carbonic anhydrase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307209854|gb|EFN86633.1| Carbonic anhydrase 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|194860429|ref|XP_001969581.1| GG23881 [Drosophila erecta] gi|190661448|gb|EDV58640.1| GG23881 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195397692|ref|XP_002057462.1| GJ18144 [Drosophila virilis] gi|194141116|gb|EDW57535.1| GJ18144 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194761138|ref|XP_001962789.1| GF14257 [Drosophila ananassae] gi|190616486|gb|EDV32010.1| GF14257 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195472701|ref|XP_002088638.1| GE18682 [Drosophila yakuba] gi|194174739|gb|EDW88350.1| GE18682 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195031434|ref|XP_001988341.1| GH11114 [Drosophila grimshawi] gi|193904341|gb|EDW03208.1| GH11114 [Drosophila grimshawi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0027844 270 CAH1 "Carbonic anhydrase 1" [D 0.992 0.481 0.641 1.8e-46
UNIPROTKB|F1RXC0 263 CA13 "Uncharacterized protein" 0.977 0.486 0.560 1.3e-34
UNIPROTKB|J9NSG2 262 CA13 "Uncharacterized protein" 0.977 0.488 0.553 7.4e-34
MGI|MGI:1931322 262 Car13 "carbonic anhydrase 13" 0.984 0.492 0.548 7.4e-34
RGD|1560453 262 Car13 "carbonic anhydrase 13" 0.984 0.492 0.548 7.4e-34
UNIPROTKB|Q8N1Q1 262 CA13 "Carbonic anhydrase 13" [ 0.977 0.488 0.530 9.5e-34
UNIPROTKB|F1MIP9 263 CA13 "Uncharacterized protein" 0.977 0.486 0.537 2e-33
UNIPROTKB|G3MX64155 CA13 "Uncharacterized protein" 0.977 0.825 0.537 2e-33
UNIPROTKB|F1PBK6 261 CA1 "Uncharacterized protein" 0.984 0.494 0.496 1.4e-32
UNIPROTKB|P43166 264 CA7 "Carbonic anhydrase 7" [Ho 0.984 0.488 0.518 2.9e-32
FB|FBgn0027844 CAH1 "Carbonic anhydrase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 487 (176.5 bits), Expect = 1.8e-46, P = 1.8e-46
 Identities = 84/131 (64%), Positives = 102/131 (77%)

Query:     2 FPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSEL 61
             +P+ASG RQSPV++  +       L   PL WKY P+ TK++ NPGYCWRVDV+G DSEL
Sbjct:    20 YPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDVNGADSEL 79

Query:    62 TGGPLHHK-YRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQP 120
             TGGPL  + ++LEQFHCHWGC  +KGSEHTVDG +Y+GELHLVHWN+ KY +FGEAA  P
Sbjct:    80 TGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAP 139

Query:   121 DGLAVLGVLLE 131
             DGLAVLGV L+
Sbjct:   140 DGLAVLGVFLK 150




GO:0004089 "carbonate dehydratase activity" evidence=ISS
GO:0006730 "one-carbon metabolic process" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1RXC0 CA13 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSG2 CA13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1931322 Car13 "carbonic anhydrase 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560453 Car13 "carbonic anhydrase 13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N1Q1 CA13 "Carbonic anhydrase 13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIP9 CA13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MX64 CA13 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBK6 CA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P43166 CA7 "Carbonic anhydrase 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9D6N1CAH13_MOUSE4, ., 2, ., 1, ., 10.53380.98470.4923yesN/A
Q92051CAHZ_DANRE4, ., 2, ., 1, ., 10.51510.96940.4884yesN/A
Q8N1Q1CAH13_HUMAN4, ., 2, ., 1, ., 10.53380.98470.4923yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer4.2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
cd00326 227 cd00326, alpha_CA, Carbonic anhydrase alpha (verte 5e-54
smart01057 247 smart01057, Carb_anhydrase, Eukaryotic-type carbon 2e-53
pfam00194 238 pfam00194, Carb_anhydrase, Eukaryotic-type carboni 9e-53
cd03119 259 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydras 6e-51
cd03149 236 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, C 8e-47
cd03118 236 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA 4e-42
cd03117 234 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase a 1e-35
cd03123 248 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydras 8e-34
cd03120 256 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha 3e-29
cd03121 256 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase 1e-27
cd03126 249 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alph 3e-27
cd03125 249 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, is 2e-26
cd03124216 cd03124, alpha_CA_prokaryotic_like, Carbonic anhyd 7e-22
cd03150 247 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, is 8e-22
cd03122 253 cd03122, alpha_CARP_receptor_like, Carbonic anhydr 3e-17
COG3338250 COG3338, Cah, Carbonic anhydrase [Inorganic ion tr 1e-13
PLN02179235 PLN02179, PLN02179, carbonic anhydrase 8e-07
>gnl|CDD|238200 cd00326, alpha_CA, Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
 Score =  168 bits (428), Expect = 5e-54
 Identities = 63/125 (50%), Positives = 84/125 (67%), Gaps = 4/125 (3%)

Query: 7   GERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSELTGGPL 66
           G+RQSP+N+ T+ V  D +L   PL + Y P  + T+ N G+  +V+ D +   L+GG L
Sbjct: 1   GKRQSPINIVTSAVVYDPSL--PPLNFDYYPTTSLTLVNNGHTVQVNFDDDGGTLSGGGL 58

Query: 67  HHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVL 126
             +Y+L QFH HWG  ++ GSEHT+DGK Y  ELHLVH+NSD YS+  EAA +P GLAVL
Sbjct: 59  PGRYKLVQFHFHWGSENSPGSEHTIDGKRYPLELHLVHYNSDYYSS--EAAKKPGGLAVL 116

Query: 127 GVLLE 131
           GV  E
Sbjct: 117 GVFFE 121


Carbonic anhydrases (CAs) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism: a nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Most alpha CAs are monomeric enzymes. The zinc ion is complexed by three histidine residues and a fourth conserved histidine plays a potential role in proton transfer. Length = 227

>gnl|CDD|215000 smart01057, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information
>gnl|CDD|201071 pfam00194, Carb_anhydrase, Eukaryotic-type carbonic anhydrase Back     alignment and domain information
>gnl|CDD|239393 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>gnl|CDD|239402 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information
>gnl|CDD|239392 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>gnl|CDD|239391 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>gnl|CDD|239397 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>gnl|CDD|239394 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>gnl|CDD|239395 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information
>gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>gnl|CDD|239399 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>gnl|CDD|239398 cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>gnl|CDD|239403 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>gnl|CDD|239396 cd03122, alpha_CARP_receptor_like, Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>gnl|CDD|225875 COG3338, Cah, Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|177835 PLN02179, PLN02179, carbonic anhydrase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
cd03121 256 alpha_CARP_X_XI_like Carbonic anhydrase alpha rela 100.0
cd03119 259 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, i 100.0
cd03120 256 alpha_CARP_VIII Carbonic anhydrase alpha related p 100.0
cd03149 236 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme 100.0
cd03150 247 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX. 100.0
cd03118 236 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_ 100.0
cd03126 249 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozyme 100.0
cd03123 248 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, i 100.0
cd03125 249 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI. 100.0
cd03122 253 alpha_CARP_receptor_like Carbonic anhydrase alpha 100.0
PF00194 256 Carb_anhydrase: Eukaryotic-type carbonic anhydrase 100.0
cd03117 234 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_I 100.0
KOG0382|consensus 262 100.0
cd00326 227 alpha_CA Carbonic anhydrase alpha (vertebrate-like 100.0
PLN02202 284 carbonate dehydratase 100.0
cd03124216 alpha_CA_prokaryotic_like Carbonic anhydrase alpha 100.0
PLN02179235 carbonic anhydrase 100.0
COG3338250 Cah Carbonic anhydrase [Inorganic ion transport an 99.97
>cd03121 alpha_CARP_X_XI_like Carbonic anhydrase alpha related protein: groups X, XI and related proteins Back     alignment and domain information
Probab=100.00  E-value=4.1e-45  Score=277.79  Aligned_cols=128  Identities=34%  Similarity=0.661  Sum_probs=115.2

Q ss_pred             CCCC-CCCCCCCceEeCCceeecCCCCCCCeeeeecCCCceEEEecCcEEEEEeCCCC-ceEecCCCCccEEeEEEEEee
Q psy14180          2 FPEA-SGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGED-SELTGGPLHHKYRLEQFHCHW   79 (131)
Q Consensus         2 ~~~c-~G~~QSPI~I~~~~~~~~~~~~l~~l~~~Y~~~~~~~i~N~g~t~~~~~~~~~-~~i~gg~l~~~Y~l~q~HfHw   79 (131)
                      |..| .|++||||||.+..+.+++.  +.+|.|+|......++.|+|||+++.+.++. ..+.||+|..+|+|.||||||
T Consensus        12 ~~~C~~G~~QSPI~I~~~~~~~~~~--l~~L~~~~~~~~~~~l~N~Ghtv~v~~~~~~~~~i~gG~l~~~Y~l~Q~HFHw   89 (256)
T cd03121          12 WNLCSKGRRQSPVDIEPSRLLFDPF--LTPLRIDTGRKVSGTFYNTGRHVSFRPDKDPVVNISGGPLSYRYRLEEIRLHF   89 (256)
T ss_pred             hhhccCCCCcCCEeEeccceEECCC--CCceeeccCCCCceEEEECCEEEEEEECCCCceEEeCCCCCCcEEEEEEEEec
Confidence            5589 69999999999988877777  8899997763346899999999999986543 267799988999999999999


Q ss_pred             cCCCCCCcceeeCCcccceeEeeEEecCCCCCChhhhcCCCCcEEEEEEEcC
Q psy14180         80 GCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE  131 (131)
Q Consensus        80 G~~~~~~SEH~idG~~~~~E~HlVh~~~~~~~~~~~a~~~~~glaVl~v~~~  131 (131)
                      |+++..||||+|||++|||||||||++.++|.+++||...++|+|||||||+
T Consensus        90 G~~~~~gSEH~idG~~yp~E~HlVH~n~~~y~~~~~A~~~~~glaVvgv~~~  141 (256)
T cd03121          90 GREDEQGSEHTVNGQAFPGEVQLIHYNSELYPNFSEASKSPNGLVIVSLFVK  141 (256)
T ss_pred             CCCCCCCCceeeCCcccCceEEEEEEcccccCCHHHHhcCCCCeEEEEEEEe
Confidence            9999999999999999999999999998899999999999999999999985



This subgroup contains carbonic anhydrase related proteins (CARPs) X and XI, which have been implicated in various biological processes of the central nervous system. CARPs are sequence similar to carbonic anhydrases. Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism. CARPs have lost conserved histidines involved in zinc binding and consequently their catalytic activity. CARP XI plays a role in the development of gastrointestinal stromal tumors.

>cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII Back     alignment and domain information
>cd03120 alpha_CARP_VIII Carbonic anhydrase alpha related protein, group VIII Back     alignment and domain information
>cd03149 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme VII_like subgroup Back     alignment and domain information
>cd03150 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX Back     alignment and domain information
>cd03118 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_like subgroup Back     alignment and domain information
>cd03126 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozymes XII and XIV Back     alignment and domain information
>cd03123 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV Back     alignment and domain information
>cd03125 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI Back     alignment and domain information
>cd03122 alpha_CARP_receptor_like Carbonic anhydrase alpha related protein, receptor_like subfamily Back     alignment and domain information
>PF00194 Carb_anhydrase: Eukaryotic-type carbonic anhydrase; InterPro: IPR001148 Carbonic anhydrases (CA: 4 Back     alignment and domain information
>cd03117 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes Back     alignment and domain information
>KOG0382|consensus Back     alignment and domain information
>cd00326 alpha_CA Carbonic anhydrase alpha (vertebrate-like) group Back     alignment and domain information
>PLN02202 carbonate dehydratase Back     alignment and domain information
>cd03124 alpha_CA_prokaryotic_like Carbonic anhydrase alpha, prokaryotic-like subfamily Back     alignment and domain information
>PLN02179 carbonic anhydrase Back     alignment and domain information
>COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3da2_A 262 X-Ray Structure Of Human Carbonic Anhydrase 13 In C 1e-35
3czv_A 264 Crystal Structure Of The Human Carbonic Anhydrase X 1e-35
3ml5_A 269 Crystal Structure Of The C183sC217S MUTANT OF HUMAN 1e-33
3mdz_A 281 Crystal Structure Of Human Carbonic Anhydrase Vii [ 1e-33
1j9w_A 260 Solution Structure Of The Cai Michigan 1 Variant Le 4e-33
2it4_A 256 X Ray Structure Of The Complex Between Carbonic Anh 3e-32
2foy_A 260 Human Carbonic Anhydrase I Complexed With A Two-Pro 3e-32
3tvo_X 258 Human Carbonic Anhydrase Ii Proton Transfer Double 4e-32
3dv7_A 259 Role Of Hydrophilic Residues In Proton Transfer Dur 4e-32
3tvn_X 258 Human Carbonic Anhydrase Ii Proton Transfer Mutant 4e-32
3dbu_A 260 Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, 4e-32
3rg4_A 260 Crystal Structure Of The W5f Mutant Of Human Carbon 5e-32
3rg3_A 260 Crystal Structure Of The W5e Mutant Of Human Carbon 5e-32
2foq_A 260 Human Carbonic Anhydrase Ii Complexed With Two-Pron 5e-32
2fnn_A 260 Activation Of Human Carbonic Anhydrase Ii By Exogen 5e-32
3rge_A 260 Crystal Structure Of The W5h Mutant Of Human Carbon 5e-32
2fnm_A 260 Activation Of Human Carbonic Anhdyrase Ii By Exogen 5e-32
4bcw_A 257 Carbonic Anhydrase Ix Mimic In Complex With (e)-2-( 5e-32
1lg5_A 260 Crystal Structure Analysis Of The Hca Ii Mutant T19 5e-32
3dvc_A 259 X-Ray Crystal Structure Of Mutant N62t Of Human Car 5e-32
3rld_A 260 Crystal Structure Of The Y7i Mutant Of Human Carbon 5e-32
3m1k_A 265 Carbonic Anhydrase In Complex With Fragment Length 5e-32
2nwo_A 260 Structural And Kinetic Effect Of Hydrophobic Mutati 5e-32
1mua_A 256 Structure And Energetics Of A Non-Proline Cis-Pepti 6e-32
4g0c_A 257 Neutron Structure Of Acetazolamide-Bound Human Carb 6e-32
3kkx_A 260 Neutron Structure Of Human Carbonic Anhydrase Ii Le 6e-32
2pov_A 259 The Crystal Structure Of The Human Carbonic Anhydra 6e-32
3mnh_A 260 Human Carbonic Anhydrase Ii Mutant K170a Length = 2 6e-32
3dvd_A 259 X-Ray Crystal Structure Of Mutant N62d Of Human Car 6e-32
1hed_A 260 Structural Consequences Of Hydrophilic Amino-Acid S 6e-32
3mnj_A 260 Human Carbonic Anhydrase Ii Mutant K170e Length = 2 6e-32
2fnk_A 260 Activation Of Human Carbonic Anhydrase Ii By Exogen 6e-32
1hec_A 260 Structural Consequences Of Hydrophilic Amino-Acid S 6e-32
3mni_A 260 Human Carbonic Anhydrase Ii Mutant K170d Length = 2 6e-32
5ca2_A 260 Conformational Mobility Of His-64 In The Thr-200 (R 6e-32
1cva_A 259 Structural And Functional Importance Of A Conserved 6e-32
1hea_A 260 Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca 6e-32
3tmj_A 258 Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHY 6e-32
3pyk_A 260 Human Carbonic Anhydrase Ii As Host For Pianostool 6e-32
3r16_A 257 Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thioph 6e-32
3mnk_A 260 Human Carbonic Anhydrase Ii Mutant K170h Length = 2 6e-32
1crm_A 260 Structure And Function Of Carbonic Anhydrases Lengt 6e-32
2nxr_A 260 Structural Effects Of Hydrophobic Mutations On The 6e-32
1g6v_A 260 Complex Of The Camelid Heavy-Chain Antibody Fragmen 6e-32
1heb_A 260 Structural Consequences Of Hydrophilic Amino-Acid S 6e-32
3dvb_A 259 X-Ray Crystal Structure Of Mutant N62v Human Carbon 6e-32
1lzv_A 260 Site-Specific Mutant (Tyr7 Replaced With His) Of Hu 6e-32
1cct_A 259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 6e-32
1cal_A 259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 6e-32
1ccs_A 259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 6e-32
1ydb_A 259 Structural Basis Of Inhibitor Affinity To Variants 6e-32
1th9_A 260 Effect Of Shuttle Location And Ph Environment On H+ 7e-32
1zh9_A 259 Carbonic Anhydrase Ii In Complex With N-4-methyl-1- 7e-32
2cbe_A 260 Structure Of Native And Apo Carbonic Anhydrase Ii A 7e-32
1xpz_A 258 Structure Of Human Carbonic Anhydrase Ii With 4-[4- 7e-32
1f2w_A 259 The Mechanism Of Cyanamide Hydration Catalyzed By C 7e-32
1ydd_A 259 Structural Basis Of Inhibitor Affinity To Variants 7e-32
1yda_A 259 Structural Basis Of Inhibitor Affinity To Variants 7e-32
2nwy_A 260 Structural And Kinetic Effects Of Hydrophobic Mutat 7e-32
1dca_A 260 Structure Of An Engineered Metal Binding Site In Hu 7e-32
3ryv_B 259 Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamo 7e-32
1bic_A 259 Crystallographic Analysis Of Thr-200-> His Human Ca 7e-32
1ccu_A 259 Structure-Assisted Redesign Of A Protein-Zinc Bindi 7e-32
1tg3_A 260 Effect Of Shuttle Location And Ph Environment On H+ 7e-32
3u3a_X 260 Structure Of Human Carbonic Anhydrase Ii V143i Leng 7e-32
1uge_A 258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 7e-32
1ugd_A 258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 8e-32
1ugf_A 258 Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M 8e-32
1uga_A 258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 9e-32
1g0e_A 260 Site-Specific Mutant (His64 Replaced With Ala) Of H 1e-31
1yo0_A 260 Proton Transfer From His200 In Human Carbonic Anhyd 1e-31
3u47_A 260 Human Carbonic Anhydrase Ii V143l Length = 260 1e-31
1cak_A 259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 1e-31
1zsa_A 259 Carbonic Anhydrase Ii Mutant E117q, Apo Form Length 1e-31
1ugb_A 258 Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu 1e-31
3v3j_A 260 Kinetic And Structural Studies Of Thermostabilized 1e-31
3v3i_B 260 Kinetic And Structural Studies Of Thermostabilized 1e-31
1caj_A 259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 2e-31
1v9e_A 259 Crystal Structure Analysis Of Bovine Carbonic Anhyd 2e-31
3m1q_A 265 Carbonic Anhydrase Ii Mutant W5c-H64c With Opened D 2e-31
1ugc_A 258 Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) M 2e-31
6ca2_A 260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 2e-31
3u45_X 260 Human Carbonic Anhydrase Ii V143a Length = 260 2e-31
3kig_A 265 Mutant Carbonic Anhydrase Ii In Complex With An Azi 2e-31
1cnh_A 259 X-Ray Crystallographic Studies Of Engineered Hydrog 2e-31
12ca_A 260 Altering The Mouth Of A Hydrophobic Pocket. Structu 2e-31
3v3f_A 260 Kinetic And Structural Studies Of Thermostabilized 2e-31
3pjj_A 259 Synthetic Dimer Of Human Carbonic Anhydrase Ii Leng 2e-31
3v3g_B 260 Kinetic And Structural Studies Of Thermostabilized 2e-31
3v3h_B 260 Kinetic And Structural Studies Of Thermostabilized 2e-31
1cai_A 259 Structural Analysis Of The Zinc Hydroxide-Thr 199-G 3e-31
1cng_A 259 X-Ray Crystallographic Studies Of Engineered Hydrog 3e-31
9ca2_A 260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 3e-31
1v9i_C 261 Crystal Structure Analysis Of The Site Specific Mut 3e-31
1cnj_A 259 X-Ray Crystallographic Studies Of Engineered Hydrog 3e-31
1cni_A 259 X-Ray Crystallographic Studies Of Engineered Hydrog 3e-31
1h9q_A 259 H119q Carbonic Anhydrase Ii Length = 259 3e-31
1h4n_A 259 H94n Carbonic Anhydrase Ii Complexed With Tris Leng 4e-31
1h9n_A 259 H119n Carbonic Anhydrase Ii Length = 259 4e-31
1cnk_A 259 X-Ray Crystallographic Studies Of Engineered Hydrog 4e-31
1g3z_A 259 Carbonic Anhydrase Ii (F131v) Length = 259 5e-31
7ca2_A 260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 5e-31
8ca2_A 260 Engineering The Hydrophobic Pocket Of Carbonic Anhy 6e-31
1cve_A 259 Structural Consequences Of Redesigning A Protein-Zi 6e-31
1cvc_A 259 Redesigning The Zinc Binding Site Of Human Carbonic 6e-31
1cvf_A 259 Structural Consequences Of Redesigning A Protein-Zi 6e-31
1fql_A 260 X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARB 1e-30
1cvd_A 255 Structural Consequences Of Redesigning A Protein-Zi 1e-30
1hva_A 260 Engineering The Zinc Binding Site Of Human Carbonic 1e-30
1cvh_A 255 Structural Consequences Of Redesigning A Protein-Zi 1e-30
1flj_A 260 Crystal Structure Of S-Glutathiolated Carbonic Anhy 1e-30
1cnb_A 259 Compensatory Plastic Effects In The Redesign Of Pro 1e-30
1fqm_A 260 X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V 5e-30
1fr7_A 260 X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M 8e-30
3uyq_A 260 Hca 3 Length = 260 2e-29
1z93_A 266 Human Carbonic Anhydrase Iii:structural And Kinetic 6e-29
1z97_A 266 Human Carbonic Anhydrase Iii: Structural And Kineti 6e-29
2hfw_A 260 Structural And Kinetic Analysis Of Proton Shuttle R 1e-28
3uyn_A 260 Hca 3 Length = 260 3e-28
1dmx_A 248 Murine Mitochondrial Carbonic Anyhdrase V At 2.45 A 2e-26
1keq_A 248 Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V 6e-26
1urt_A 248 Murine Carbonic Anhydrase V Length = 248 8e-26
2w2j_A 291 Crystal Structure Of The Human Carbonic Anhydrase R 2e-22
4e9o_X 269 Vaccinia D8l Ectodomain Structure Length = 269 1e-20
1rj5_A 261 Crystal Structure Of The Extracellular Domain Of Mu 1e-17
1jcz_A 263 Crystal Structure Of The Extracellular Domain Of Hu 2e-16
3fe4_A 278 Crystal Structure Of Human Carbonic Anhydrase Vi Le 3e-15
1znc_A 266 Human Carbonic Anhydrase Iv Length = 266 1e-14
3iai_A 257 Crystal Structure Of The Catalytic Domain Of The Tu 1e-13
3jxf_A 272 Ca-Like Domain Of Human Ptprz Length = 272 1e-09
3s97_A 273 Ptprz Cntn1 Complex Length = 273 1e-09
2znc_A 258 Murine Carbonic Anhydrase Iv Length = 258 7e-09
3jxh_C 265 Ca-Like Domain Of Human Ptprg Length = 265 5e-06
3jxg_B 269 Ca-Like Domain Of Mouse Ptprg Length = 269 8e-06
>pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex With Inhibitor Length = 262 Back     alignment and structure

Iteration: 1

Score = 144 bits (364), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 71/133 (53%), Positives = 90/133 (67%), Gaps = 4/133 (3%) Query: 1 MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGED-- 58 FP A G++QSP+ + T +V D +L +PL+ KY+P K I+N G+ + VD D + Sbjct: 21 FFPIADGDQQSPIEIKTKEVKYDSSL--RPLSIKYDPSSAKIISNSGHSFNVDFDDTENK 78 Query: 59 SELTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAG 118 S L GGPL YRL Q H HWG + GSEH VDG +YA ELH+VHWNSDKY +F EAA Sbjct: 79 SVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAH 138 Query: 119 QPDGLAVLGVLLE 131 +PDGLAVLGV L+ Sbjct: 139 EPDGLAVLGVFLQ 151
>pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In Complex With Acetazolamide Length = 264 Back     alignment and structure
>pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII IN COMPLEX With Acetazolamide Length = 269 Back     alignment and structure
>pdb|3MDZ|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vii [isoform 1], Ca7 Length = 281 Back     alignment and structure
>pdb|1J9W|A Chain A, Solution Structure Of The Cai Michigan 1 Variant Length = 260 Back     alignment and structure
>pdb|2IT4|A Chain A, X Ray Structure Of The Complex Between Carbonic Anhydrase I And The Phosphonate Antiviral Drug Foscarnet Length = 256 Back     alignment and structure
>pdb|2FOY|A Chain A, Human Carbonic Anhydrase I Complexed With A Two-Prong Inhibitor Length = 260 Back     alignment and structure
>pdb|3TVO|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Double Mutant Length = 258 Back     alignment and structure
>pdb|3DV7|A Chain A, Role Of Hydrophilic Residues In Proton Transfer During Catalysis By Human Carbonic Anhydrase Ii (N62a) Length = 259 Back     alignment and structure
>pdb|3TVN|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Mutant Length = 258 Back     alignment and structure
>pdb|3DBU|A Chain A, Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, For The Purpose Of Screening Inhibitors For Possible Anti-Cancer Properties Length = 260 Back     alignment and structure
>pdb|3RG4|A Chain A, Crystal Structure Of The W5f Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3RG3|A Chain A, Crystal Structure Of The W5e Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FOQ|A Chain A, Human Carbonic Anhydrase Ii Complexed With Two-Prong Inhibitors Length = 260 Back     alignment and structure
>pdb|2FNN|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|3RGE|A Chain A, Crystal Structure Of The W5h Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2FNM|A Chain A, Activation Of Human Carbonic Anhdyrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|4BCW|A Chain A, Carbonic Anhydrase Ix Mimic In Complex With (e)-2-(5-bromo- 2-hydroxyphenyl)ethenesulfonic Acid Length = 257 Back     alignment and structure
>pdb|1LG5|A Chain A, Crystal Structure Analysis Of The Hca Ii Mutant T199p In Complex With Beta-Mercaptoethanol Length = 260 Back     alignment and structure
>pdb|3DVC|A Chain A, X-Ray Crystal Structure Of Mutant N62t Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3RLD|A Chain A, Crystal Structure Of The Y7i Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3M1K|A Chain A, Carbonic Anhydrase In Complex With Fragment Length = 265 Back     alignment and structure
>pdb|2NWO|A Chain A, Structural And Kinetic Effect Of Hydrophobic Mutations In The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1MUA|A Chain A, Structure And Energetics Of A Non-Proline Cis-Peptidyl Linkage In An Engineered Protein Length = 256 Back     alignment and structure
>pdb|4G0C|A Chain A, Neutron Structure Of Acetazolamide-Bound Human Carbonic Anhydrase Ii Reveal Molecular Details Of Drug Binding Length = 257 Back     alignment and structure
>pdb|3KKX|A Chain A, Neutron Structure Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|2POV|A Chain A, The Crystal Structure Of The Human Carbonic Anhydrase Ii In Complex With 4-Amino-6-Chloro-Benzene-1,3-Disulfonamide Length = 259 Back     alignment and structure
>pdb|3MNH|A Chain A, Human Carbonic Anhydrase Ii Mutant K170a Length = 260 Back     alignment and structure
>pdb|3DVD|A Chain A, X-Ray Crystal Structure Of Mutant N62d Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1HED|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3MNJ|A Chain A, Human Carbonic Anhydrase Ii Mutant K170e Length = 260 Back     alignment and structure
>pdb|2FNK|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 Back     alignment and structure
>pdb|1HEC|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3MNI|A Chain A, Human Carbonic Anhydrase Ii Mutant K170d Length = 260 Back     alignment and structure
>pdb|5CA2|A Chain A, Conformational Mobility Of His-64 In The Thr-200 (Right Arrow) Ser Mutant Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CVA|A Chain A, Structural And Functional Importance Of A Conserved Hydrogen Bond Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1HEA|A Chain A, Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca Ii) (E.C.4.2.1.1) Mutant With Leu 198 Replaced By Arg (L198r) Length = 260 Back     alignment and structure
>pdb|3TMJ|A Chain A, Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHYDRASE II AT PH 7.8 Length = 258 Back     alignment and structure
>pdb|3PYK|A Chain A, Human Carbonic Anhydrase Ii As Host For Pianostool Complexes Bearing A Sulfonamide Anchor Length = 260 Back     alignment and structure
>pdb|3R16|A Chain A, Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thiophen-2-Yl) Acetamide Length = 257 Back     alignment and structure
>pdb|3MNK|A Chain A, Human Carbonic Anhydrase Ii Mutant K170h Length = 260 Back     alignment and structure
>pdb|1CRM|A Chain A, Structure And Function Of Carbonic Anhydrases Length = 260 Back     alignment and structure
>pdb|2NXR|A Chain A, Structural Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1G6V|A Chain A, Complex Of The Camelid Heavy-Chain Antibody Fragment Cab- Ca05 With Bovine Carbonic Anhydrase Length = 260 Back     alignment and structure
>pdb|1HEB|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3DVB|A Chain A, X-Ray Crystal Structure Of Mutant N62v Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1LZV|A Chain A, Site-Specific Mutant (Tyr7 Replaced With His) Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CCT|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1CAL|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CCS|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1YDB|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1TH9|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1ZH9|A Chain A, Carbonic Anhydrase Ii In Complex With N-4-methyl-1- Piperazinyl-n'-(p-sulfonamide)phenylthiourea As Sulfonamide Inhibitor Length = 259 Back     alignment and structure
>pdb|2CBE|A Chain A, Structure Of Native And Apo Carbonic Anhydrase Ii And Some Of Its Anion-Ligand Complexes Length = 260 Back     alignment and structure
>pdb|1XPZ|A Chain A, Structure Of Human Carbonic Anhydrase Ii With 4-[4-O- Sulfamoylbenzyl)(4-Cyanophenyl)amino]-4h-[1,2, 4]-Triazole Length = 258 Back     alignment and structure
>pdb|1F2W|A Chain A, The Mechanism Of Cyanamide Hydration Catalyzed By Carbonic Anhydrase Ii Revealed By Cryogenic X-Ray Diffraction Length = 259 Back     alignment and structure
>pdb|1YDD|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1YDA|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|2NWY|A Chain A, Structural And Kinetic Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1DCA|A Chain A, Structure Of An Engineered Metal Binding Site In Human Carbonic Anhydrase Ii Reveals The Architecture Of A Regulatory Cysteine Switch Length = 260 Back     alignment and structure
>pdb|3RYV|B Chain B, Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamoylbenzamide Length = 259 Back     alignment and structure
>pdb|1BIC|A Chain A, Crystallographic Analysis Of Thr-200-> His Human Carbonic Anhydrase Ii And Its Complex With The Substrate, Hco3- Length = 259 Back     alignment and structure
>pdb|1CCU|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 Back     alignment and structure
>pdb|1TG3|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3U3A|X Chain X, Structure Of Human Carbonic Anhydrase Ii V143i Length = 260 Back     alignment and structure
>pdb|1UGE|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Leu (A65l) Length = 258 Back     alignment and structure
>pdb|1UGD|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Ser (A65s) Length = 258 Back     alignment and structure
>pdb|1UGF|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Thr (A65t) Length = 258 Back     alignment and structure
>pdb|1UGA|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Phe (A65f) Length = 258 Back     alignment and structure
>pdb|1G0E|A Chain A, Site-Specific Mutant (His64 Replaced With Ala) Of Human Carbonic Anhydrase Ii Complexed With 4-Methylimidazole Length = 260 Back     alignment and structure
>pdb|1YO0|A Chain A, Proton Transfer From His200 In Human Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3U47|A Chain A, Human Carbonic Anhydrase Ii V143l Length = 260 Back     alignment and structure
>pdb|1CAK|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1ZSA|A Chain A, Carbonic Anhydrase Ii Mutant E117q, Apo Form Length = 259 Back     alignment and structure
>pdb|1UGB|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Gly (A65g) Length = 258 Back     alignment and structure
>pdb|3V3J|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3V3I|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|1CAJ|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1V9E|A Chain A, Crystal Structure Analysis Of Bovine Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3M1Q|A Chain A, Carbonic Anhydrase Ii Mutant W5c-H64c With Opened Disulfide Bond Length = 265 Back     alignment and structure
>pdb|1UGC|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) Mutant With Ala 65 Replaced By His (a65h) Length = 258 Back     alignment and structure
>pdb|6CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|3U45|X Chain X, Human Carbonic Anhydrase Ii V143a Length = 260 Back     alignment and structure
>pdb|3KIG|A Chain A, Mutant Carbonic Anhydrase Ii In Complex With An Azide And An Alkyne Length = 265 Back     alignment and structure
>pdb|1CNH|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|12CA|A Chain A, Altering The Mouth Of A Hydrophobic Pocket. Structure And Kinetics Of Human Carbonic Anhydrase Ii Mutants At Residue Val-121 Length = 260 Back     alignment and structure
>pdb|3V3F|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3PJJ|A Chain A, Synthetic Dimer Of Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|3V3G|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|3V3H|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 Back     alignment and structure
>pdb|1CAI|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CNG|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|9CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1V9I|C Chain C, Crystal Structure Analysis Of The Site Specific Mutant (Q253c) Of Bovine Carbonic Anhydrase Ii Length = 261 Back     alignment and structure
>pdb|1CNJ|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1CNI|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1H9Q|A Chain A, H119q Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1H4N|A Chain A, H94n Carbonic Anhydrase Ii Complexed With Tris Length = 259 Back     alignment and structure
>pdb|1H9N|A Chain A, H119n Carbonic Anhydrase Ii Length = 259 Back     alignment and structure
>pdb|1CNK|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1G3Z|A Chain A, Carbonic Anhydrase Ii (F131v) Length = 259 Back     alignment and structure
>pdb|7CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|8CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 Back     alignment and structure
>pdb|1CVE|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1CVC|A Chain A, Redesigning The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of A His2asp-Zn2+ Metal Coordination Polyhedron Length = 259 Back     alignment and structure
>pdb|1CVF|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 Back     alignment and structure
>pdb|1FQL|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARBONIC Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|1CVD|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|1HVA|A Chain A, Engineering The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of The His-94-> Cys Apoenzyme In A New Crystalline Form Length = 260 Back     alignment and structure
>pdb|1CVH|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 Back     alignment and structure
>pdb|1FLJ|A Chain A, Crystal Structure Of S-Glutathiolated Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|1CNB|A Chain A, Compensatory Plastic Effects In The Redesign Of Protein- Zinc Binding Sites Length = 259 Back     alignment and structure
>pdb|1FQM|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|1FR7|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M Carbonic Anhydrase (Caii) Variant Length = 260 Back     alignment and structure
>pdb|3UYQ|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|1Z93|A Chain A, Human Carbonic Anhydrase Iii:structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|1Z97|A Chain A, Human Carbonic Anhydrase Iii: Structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 Back     alignment and structure
>pdb|2HFW|A Chain A, Structural And Kinetic Analysis Of Proton Shuttle Residues In The Active Site Of Human Carbonic Anhydrase Iii Length = 260 Back     alignment and structure
>pdb|3UYN|A Chain A, Hca 3 Length = 260 Back     alignment and structure
>pdb|1DMX|A Chain A, Murine Mitochondrial Carbonic Anyhdrase V At 2.45 Angstroms Resolution Length = 248 Back     alignment and structure
>pdb|1KEQ|A Chain A, Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V, Covalently Modified With 4-Chloromethylimidazole Length = 248 Back     alignment and structure
>pdb|1URT|A Chain A, Murine Carbonic Anhydrase V Length = 248 Back     alignment and structure
>pdb|2W2J|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Related Protein Viii Length = 291 Back     alignment and structure
>pdb|4E9O|X Chain X, Vaccinia D8l Ectodomain Structure Length = 269 Back     alignment and structure
>pdb|1RJ5|A Chain A, Crystal Structure Of The Extracellular Domain Of Murine Carbonic Anhydrase Xiv Length = 261 Back     alignment and structure
>pdb|1JCZ|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Carbonic Anhydrase Xii Length = 263 Back     alignment and structure
>pdb|3FE4|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vi Length = 278 Back     alignment and structure
>pdb|1ZNC|A Chain A, Human Carbonic Anhydrase Iv Length = 266 Back     alignment and structure
>pdb|3IAI|A Chain A, Crystal Structure Of The Catalytic Domain Of The Tumor-Associated Human Carbonic Anhydrase Ix Length = 257 Back     alignment and structure
>pdb|3JXF|A Chain A, Ca-Like Domain Of Human Ptprz Length = 272 Back     alignment and structure
>pdb|3S97|A Chain A, Ptprz Cntn1 Complex Length = 273 Back     alignment and structure
>pdb|2ZNC|A Chain A, Murine Carbonic Anhydrase Iv Length = 258 Back     alignment and structure
>pdb|3JXH|C Chain C, Ca-Like Domain Of Human Ptprg Length = 265 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1keq_A 248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 3e-58
2foy_A 260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 1e-54
4e9o_X 269 D8L antigen, IMV membrane protein; CAH alpha fold, 4e-54
3d0n_A 264 Carbonic anhydrase 13; lyase, metal-binding, metal 4e-54
3ml5_A 269 Carbonic anhydrase 7; protein-inhibitor complex, l 7e-54
3k34_A 260 Carbonic anhydrase 2; atomic resolution, sulfonami 3e-53
2w2j_A 291 Carbonic anhydrase-related protein; lyase, metal-b 3e-53
2hfx_A 260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 4e-53
1rj5_A 261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 3e-51
3iai_A 257 Carbonic anhydrase 9; transmembrane proteins, cell 1e-50
3fw3_A 266 Carbonic anhydrase 4; structure-based drug design. 8e-50
1jd0_A 263 Carbonic anhydrase XII; extracellular domain, bito 4e-49
3jxg_A 269 Receptor-type tyrosine-protein phosphatase gamma; 4e-49
3jxf_A 272 Receptor-type tyrosine-protein phosphatase zeta; C 2e-48
2znc_A 258 Carbonic anhydrase IV; lyase, zinc, murine, membra 3e-48
3fe4_A 278 Carbonic anhydrase 6; secretion, metal binding, st 1e-46
1y7w_A 291 Halotolerant alpha-type carbonic anhydrase (DCA I; 7e-43
3q31_A 244 Carbonic anhydrase; glysosy secreted, dimeric, lya 6e-35
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 1e-34
3b1b_A 377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 9e-33
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Length = 248 Back     alignment and structure
 Score =  179 bits (456), Expect = 3e-58
 Identities = 60/129 (46%), Positives = 78/129 (60%), Gaps = 4/129 (3%)

Query: 5   ASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDG--EDSELT 62
           A+G RQSP+N+       D  L   PL   Y+    + + N GY ++V+ D   EDS ++
Sbjct: 2   ATGTRQSPINIQWKDSVYDPQL--APLRVSYDAASCRYLWNTGYAFQVEFDDSCEDSGIS 59

Query: 63  GGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDG 122
           GGPL + YRL+QFH HWG     GSEH VDG  Y  ELHLVHWNS KY    +A+   +G
Sbjct: 60  GGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENCKKASVGENG 119

Query: 123 LAVLGVLLE 131
           LAV+GV L+
Sbjct: 120 LAVIGVFLK 128


>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Length = 260 Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Length = 269 Back     alignment and structure
>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Length = 264 Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} PDB: 3mdz_A* Length = 269 Back     alignment and structure
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Length = 260 Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Length = 291 Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Length = 261 Back     alignment and structure
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} Length = 257 Back     alignment and structure
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} PDB: 1znc_A* 3f7b_A* 3f7u_A* Length = 266 Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Length = 263 Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} PDB: 3s97_A* Length = 272 Back     alignment and structure
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Length = 258 Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} Length = 278 Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Length = 291 Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Length = 244 Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Length = 223 Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Length = 377 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2foy_A 260 Carbonic anhydrase 1; lyase, zinc, inhibitor, copp 100.0
3d0n_A 264 Carbonic anhydrase 13; lyase, metal-binding, metal 100.0
3k34_A 260 Carbonic anhydrase 2; atomic resolution, sulfonami 100.0
2hfx_A 260 Carbonic anhydrase 3; proton shuttle, HCA III, pro 100.0
3ml5_A 269 Carbonic anhydrase 7; protein-inhibitor complex, l 100.0
1keq_A 248 F65A/Y131C-MI carbonic anhydrase V; proton transfe 100.0
2w2j_A 291 Carbonic anhydrase-related protein; lyase, metal-b 100.0
3fw3_A 266 Carbonic anhydrase 4; structure-based drug design. 100.0
3jxf_A 272 Receptor-type tyrosine-protein phosphatase zeta; C 100.0
3jxg_A 269 Receptor-type tyrosine-protein phosphatase gamma; 100.0
1rj5_A 261 Carbonic anhydrase XIV; beta-sheet, alpha-helix, z 100.0
3fe4_A 278 Carbonic anhydrase 6; secretion, metal binding, st 100.0
1jd0_A 263 Carbonic anhydrase XII; extracellular domain, bito 100.0
4e9o_X 269 D8L antigen, IMV membrane protein; CAH alpha fold, 100.0
3iai_A 257 Carbonic anhydrase 9; transmembrane proteins, cell 100.0
2znc_A 258 Carbonic anhydrase IV; lyase, zinc, murine, membra 100.0
1kop_A223 Carbonic anhydrase; lyase, structural trimming; 1. 100.0
3q31_A 244 Carbonic anhydrase; glysosy secreted, dimeric, lya 100.0
1y7w_A 291 Halotolerant alpha-type carbonic anhydrase (DCA I; 100.0
3b1b_A 377 Carbonic anhydrase 1; N-glycosylation, zinc-finger 100.0
>2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Back     alignment and structure
Probab=100.00  E-value=8.3e-48  Score=292.05  Aligned_cols=128  Identities=50%  Similarity=0.919  Sum_probs=119.3

Q ss_pred             CCCCCCCCCCCceEeCCceeecCCCCCCCeeeeecCCCceEEEecCcEEEEEeCCCC--ceEecCCCCccEEeEEEEEee
Q psy14180          2 FPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGED--SELTGGPLHHKYRLEQFHCHW   79 (131)
Q Consensus         2 ~~~c~G~~QSPI~I~~~~~~~~~~~~l~~l~~~Y~~~~~~~i~N~g~t~~~~~~~~~--~~i~gg~l~~~Y~l~q~HfHw   79 (131)
                      ||.|.|++||||||.+..+.+++.  +++|.|.|+.....+|.|+|||+++.+.++.  ..+.||+|..+|+|.||||||
T Consensus        20 ~~~c~G~~QSPInI~~~~~~~~~~--l~~l~~~Y~~~~~~~l~N~Ghtv~v~~~~~~~~~~i~gG~L~~~Y~l~Q~HfHW   97 (260)
T 2foy_A           20 YPIANGNNQSPVDIKTSETKHDTS--LKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHW   97 (260)
T ss_dssp             CGGGGSSSCSCCEECTTSCEECTT--CCCEEEECCGGGEEEEEECSSCEEEEECCSSSSSEEEETTCSSCEEEEEEEEEE
T ss_pred             ccCCCCCeeCCEeEccCceeEcCC--CcCeeeeecCCcceEEEeCCcEEEEEeCCCCcceEEeCCCCCceEEEEEEEEec
Confidence            677999999999999998888888  8899999986566899999999999998763  489999999999999999999


Q ss_pred             cCCCCCCcceeeCCcccceeEeeEEecCCCCCChhhhcCCCCcEEEEEEEcC
Q psy14180         80 GCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE  131 (131)
Q Consensus        80 G~~~~~~SEH~idG~~~~~E~HlVh~~~~~~~~~~~a~~~~~glaVl~v~~~  131 (131)
                      |+.+..||||+|||++|||||||||++.++|.+++||+++++|||||||||+
T Consensus        98 G~~~~~gSEHtidg~~~p~ElHlVH~n~~~y~~~~eA~~~~~glaVlgv~~~  149 (260)
T 2foy_A           98 GSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK  149 (260)
T ss_dssp             CSSTTCCCSSEETTBCCSEEEEEEEEETTTCSSHHHHTTSTTSEEEEEEEEE
T ss_pred             CCCCCCCCccccccccCCceeEEEEecccccCCHHHHhhCCCceEEEEEEEE
Confidence            9999999999999999999999999998899999999999999999999985



>3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Back     alignment and structure
>3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} SCOP: b.74.1.1 PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Back     alignment and structure
>3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} SCOP: b.74.1.1 PDB: 3mdz_A* Back     alignment and structure
>1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Back     alignment and structure
>2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Back     alignment and structure
>3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} SCOP: b.74.1.1 PDB: 1znc_A* 3f7b_A* 3f7u_A* Back     alignment and structure
>3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} SCOP: b.74.1.0 PDB: 3s97_A* Back     alignment and structure
>1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Back     alignment and structure
>3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Back     alignment and structure
>4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Back     alignment and structure
>3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} SCOP: b.74.1.0 Back     alignment and structure
>2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Back     alignment and structure
>1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Back     alignment and structure
>3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Back     alignment and structure
>1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Back     alignment and structure
>3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1hcba_ 258 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 3e-40
d1flja_ 259 b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norv 1e-39
d1rj6a_ 259 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 2e-39
d1keqa_ 238 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 9e-39
d1luga_ 259 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 2e-37
d1znca_ 262 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 9e-36
d1jd0a_ 260 b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi 2e-34
d2znca_ 258 b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu 1e-29
d1kopa_223 b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorr 5e-19
>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Length = 258 Back     information, alignment and structure

class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]
 Score =  132 bits (333), Expect = 3e-40
 Identities = 64/133 (48%), Positives = 87/133 (65%), Gaps = 4/133 (3%)

Query: 1   MFPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGEDSE 60
           ++P A+G  QSPV++ T++   D +L  KP++  YNP   K I N G+ + V+ +  D+ 
Sbjct: 17  LYPIANGNNQSPVDIKTSETKHDTSL--KPISVSYNPATAKEIINVGHSFHVNFEDNDNR 74

Query: 61  --LTGGPLHHKYRLEQFHCHWGCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAG 118
             L GGP    YRL QFH HWG  +  GSEHTVDG  Y+ ELH+ HWNS KYS+  EAA 
Sbjct: 75  SVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAAS 134

Query: 119 QPDGLAVLGVLLE 131
           + DGLAV+GVL++
Sbjct: 135 KADGLAVIGVLMK 147


>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Length = 259 Back     information, alignment and structure
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Length = 238 Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Length = 223 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1flja_ 259 Carbonic anhydrase {Rat (Rattus norvegicus), isozy 100.0
d1hcba_ 258 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1luga_ 259 Carbonic anhydrase {Human (Homo sapiens), erythroc 100.0
d1znca_ 262 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d1keqa_ 238 Carbonic anhydrase {Mouse (Mus musculus), liver, i 100.0
d1jd0a_ 260 Carbonic anhydrase {Human (Homo sapiens), isozyme 100.0
d1rj6a_ 259 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d2znca_ 258 Carbonic anhydrase {Mouse (Mus musculus), isozyme 100.0
d1kopa_223 Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 99.97
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Carbonic anhydrase
superfamily: Carbonic anhydrase
family: Carbonic anhydrase
domain: Carbonic anhydrase
species: Rat (Rattus norvegicus), isozyme III [TaxId: 10116]
Probab=100.00  E-value=1.1e-42  Score=261.77  Aligned_cols=127  Identities=53%  Similarity=0.924  Sum_probs=116.1

Q ss_pred             CCCCCCCCCCCceEeCCceeecCCCCCCCeeeeecCCCceEEEecCcEEEEEeCCCC--ceEecCCCCccEEeEEEEEee
Q psy14180          2 FPEASGERQSPVNVDTTKVSSDKTLEEKPLTWKYNPDKTKTITNPGYCWRVDVDGED--SELTGGPLHHKYRLEQFHCHW   79 (131)
Q Consensus         2 ~~~c~G~~QSPI~I~~~~~~~~~~~~l~~l~~~Y~~~~~~~i~N~g~t~~~~~~~~~--~~i~gg~l~~~Y~l~q~HfHw   79 (131)
                      ||.|+|++||||||.+..+...+.  +.+|.++|+.....++.|+|+++++.+++..  ..+.||++..+|+|.||||||
T Consensus        19 ~~c~~G~~QSPInI~~~~~~~~~~--l~~l~~~y~~~~~~~l~N~G~t~~~~~~~~~~~~~~~gg~l~~~Y~l~q~hfHw   96 (259)
T d1flja_          19 YPIAKGDNQSPIELHTKDIRHDPS--LQPWSVSYDPGSAKTILNNGKTCRVVFDDTFDRSMLRGGPLSGPYRLRQFHLHW   96 (259)
T ss_dssp             CGGGGSSSCSCCEECGGGEEECTT--CCCEEEECCGGGEEEEEECSSCEEEEECCSSSSSEEEETTCSSCEEEEEEEEEE
T ss_pred             ccCCCCCccCCEeECcCceeECCC--CCceeeeccCCCceEEEecCeEEEEEEcCCCCeeEEecCccccceeeEEEEEEe
Confidence            455699999999999999988877  8899999987667889999999999987653  378999999999999999999


Q ss_pred             cCCCCCCcceeeCCcccceeEeeEEecCCCCCChhhhcCCCCcEEEEEEEcC
Q psy14180         80 GCVSNKGSEHTVDGKAYAGELHLVHWNSDKYSTFGEAAGQPDGLAVLGVLLE  131 (131)
Q Consensus        80 G~~~~~~SEH~idG~~~~~E~HlVh~~~~~~~~~~~a~~~~~glaVl~v~~~  131 (131)
                      |+.+..||||+|||++|||||||||++. .|.++.+|++.++++||||+|++
T Consensus        97 G~~~~~gSEH~idG~~~~~E~h~VH~n~-~~~~~~~a~~~~~~lav~~v~~~  147 (259)
T d1flja_          97 GSSDDHGSEHTVDGVKYAAELHLVHWNP-KYNTFGEALKQPDGIAVVGIFLK  147 (259)
T ss_dssp             CSSTTCCCSSEETTBCCSEEEEEEEECG-GGSSHHHHTTSTTSEEEEEEEEE
T ss_pred             CCCCCCCcceeECCEecCCceEEEEecC-CCCCHHHHhcCCCCcEEEEEEEe
Confidence            9999999999999999999999999997 89999999999999999999974



>d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Back     information, alignment and structure
>d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Back     information, alignment and structure
>d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Back     information, alignment and structure
>d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Back     information, alignment and structure
>d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Back     information, alignment and structure
>d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Back     information, alignment and structure
>d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Back     information, alignment and structure
>d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure