Diaphorina citri psyllid: psy14197


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MQKPAPTPAISPASLDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDGNFIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEDLFHKLTGGW
ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEEEEEcccccccccEEEEccccEEEECcccccEEEEEEccccEEEcccccEEEEEEEEccccEEEEEEcccHHHHHHHHHHcccEEEEccHHHccccHHHHHHccccc
**************LDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDGNFIFECQSADCKVVHEFIGGYIFLSMR***********LFHKLTGG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQKPAPTPAISPASLDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDGNFIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEDLFHKLTGGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Unc-112-related protein Probably involved in cell adhesion.confidentQ9VZI3
Fermitin family homolog 2 Participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.confidentQ96AC1
Fermitin family homolog 1 Involved in cell adhesion. Contributes to integrin activation. When co-expressed with talin, potentiates activation of ITGA2B. Required for normal keratinocyte proliferation. Required for normal polarization of basal keratinocytes in skin, and for normal cell shape. Required for normal adhesion of keratinocytes to fibronectin and laminin, and for normal keratinocyte migration to wound sites.confidentQ5R8M5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050839 [MF]cell adhesion molecule bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0031941 [CC]filamentous actinprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005884, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0090162 [BP]establishment of epithelial cell polarityprobableGO:0009987, GO:0007163, GO:0008150, GO:0030010, GO:0044763, GO:0044699
GO:0001725 [CC]stress fiberprobableGO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0007160 [BP]cell-matrix adhesionprobableGO:0031589, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055120 [CC]striated muscle dense bodyprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0031430 [CC]M bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0031672, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0043616 [BP]keratinocyte proliferationprobableGO:0008283, GO:0008150, GO:0044699, GO:0050673
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0051546 [BP]keratinocyte migrationprobableGO:0040011, GO:0032501, GO:0010631, GO:0044707, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0051179, GO:0008150, GO:0001667, GO:0016477, GO:0090132, GO:0044699, GO:0090130
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F7G, chain A
Confidence level:very confident
Coverage over the Query: 14-157
View the alignment between query and template
View the model in PyMOL