Psyllid ID: psy14197
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| 321463775 | 697 | hypothetical protein DAPPUDRAFT_199712 [ | 1.0 | 0.255 | 0.735 | 1e-77 | |
| 307178489 | 664 | Unc-112-related protein [Camponotus flor | 1.0 | 0.268 | 0.730 | 1e-77 | |
| 307200435 | 665 | Unc-112-related protein [Harpegnathos sa | 1.0 | 0.267 | 0.724 | 3e-77 | |
| 350417495 | 713 | PREDICTED: unc-112-related protein-like | 1.0 | 0.249 | 0.724 | 4e-77 | |
| 332019227 | 664 | Unc-112-related protein [Acromyrmex echi | 1.0 | 0.268 | 0.724 | 6e-77 | |
| 328785955 | 713 | PREDICTED: unc-112-related protein-like | 1.0 | 0.249 | 0.719 | 1e-76 | |
| 380026009 | 713 | PREDICTED: unc-112-related protein-like | 1.0 | 0.249 | 0.719 | 1e-76 | |
| 340714139 | 711 | PREDICTED: unc-112-related protein-like | 1.0 | 0.250 | 0.719 | 2e-76 | |
| 189239630 | 704 | PREDICTED: similar to Fermitin, putative | 0.994 | 0.251 | 0.730 | 4e-76 | |
| 270010684 | 711 | hypothetical protein TcasGA2_TC010123 [T | 0.994 | 0.248 | 0.730 | 5e-76 |
| >gi|321463775|gb|EFX74788.1| hypothetical protein DAPPUDRAFT_199712 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 294 bits (752), Expect = 1e-77, Method: Compositional matrix adjust.
Identities = 131/178 (73%), Positives = 161/178 (90%)
Query: 1 MQKPAPTPAISPASLDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIR 60
MQKPAP PAI+P+SLDI +DYV+ R+I+KL++K+S RILEAH NVKDL LTEAKL+YI+
Sbjct: 519 MQKPAPAPAINPSSLDIQPDDYVAPRFIRKLKNKVSTRILEAHTNVKDLSLTEAKLNYIK 578
Query: 61 AWQSLPDYGLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWE 120
AWQSLP+YG++LFV+K MG +KEELLGV +RLMRM+L++GDH++TWRY+T+KAWNVNWE
Sbjct: 579 AWQSLPEYGVSLFVVKFMGQRKEELLGVAFNRLMRMDLTTGDHIKTWRYNTMKAWNVNWE 638
Query: 121 IKHMMLQLTDGNFIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEDLFHKLTGGW 178
+KHMM+Q + + IF C SADCKVVHEFIGGYIFLSMRSK+ANQTLNE+LFHKLTGGW
Sbjct: 639 VKHMMVQFEEESVIFSCLSADCKVVHEFIGGYIFLSMRSKEANQTLNEELFHKLTGGW 696
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307178489|gb|EFN67178.1| Unc-112-related protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307200435|gb|EFN80644.1| Unc-112-related protein [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350417495|ref|XP_003491450.1| PREDICTED: unc-112-related protein-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332019227|gb|EGI59737.1| Unc-112-related protein [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328785955|ref|XP_392367.3| PREDICTED: unc-112-related protein-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380026009|ref|XP_003696754.1| PREDICTED: unc-112-related protein-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340714139|ref|XP_003395589.1| PREDICTED: unc-112-related protein-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|189239630|ref|XP_970799.2| PREDICTED: similar to Fermitin, putative [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270010684|gb|EFA07132.1| hypothetical protein TcasGA2_TC010123 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 178 | ||||||
| FB|FBgn0035498 | 708 | Fit1 "Fermitin 1" [Drosophila | 0.988 | 0.248 | 0.661 | 1.1e-62 | |
| FB|FBgn0036688 | 715 | Fit2 "Fermitin 2" [Drosophila | 1.0 | 0.248 | 0.646 | 3e-62 | |
| UNIPROTKB|F1NPF7 | 684 | FERMT1 "Uncharacterized protei | 0.971 | 0.252 | 0.525 | 1.1e-48 | |
| UNIPROTKB|E1C0T6 | 680 | PLEKHC1 "Uncharacterized prote | 1.0 | 0.261 | 0.521 | 2.9e-48 | |
| UNIPROTKB|Q96AC1 | 680 | FERMT2 "Fermitin family homolo | 1.0 | 0.261 | 0.516 | 2.9e-48 | |
| ZFIN|ZDB-GENE-030131-3264 | 666 | fermt1 "fermitin family member | 0.994 | 0.265 | 0.521 | 2.9e-48 | |
| UNIPROTKB|A7MB21 | 680 | FERMT2 "Uncharacterized protei | 1.0 | 0.261 | 0.516 | 4.7e-48 | |
| UNIPROTKB|F1PFB4 | 630 | FERMT2 "Uncharacterized protei | 1.0 | 0.282 | 0.516 | 4.7e-48 | |
| UNIPROTKB|F1SFE3 | 505 | LOC100154173 "Uncharacterized | 1.0 | 0.352 | 0.516 | 7.7e-48 | |
| MGI|MGI:2385001 | 680 | Fermt2 "fermitin family homolo | 1.0 | 0.261 | 0.510 | 7.7e-48 |
| FB|FBgn0035498 Fit1 "Fermitin 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 640 (230.4 bits), Expect = 1.1e-62, P = 1.1e-62
Identities = 119/180 (66%), Positives = 149/180 (82%)
Query: 1 MQKPAP-TP-AISPASLDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSY 58
MQKPA P ++P S++ DY+S + ++KL SK QRILEAHANV+ L L +AK+ Y
Sbjct: 530 MQKPAQGAPLTVNPRSVE--PMDYLSPKMMRKLSSKAVQRILEAHANVRQLSLMDAKMKY 587
Query: 59 IRAWQSLPDYGLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVN 118
I+AWQSLPD+G+TLF+IK GHKKEELLGV +R+MRM+L++GDH++TWRY+T+KAWNVN
Sbjct: 588 IQAWQSLPDFGVTLFIIKFDGHKKEELLGVANNRIMRMDLNTGDHIKTWRYNTMKAWNVN 647
Query: 119 WEIKHMMLQLTDGNFIFECQSADCKVVHEFIGGYIFLSMRSKDANQTLNEDLFHKLTGGW 178
W IK MM+QL D N +F QSADCKVVHEFIGGYIF+SMRSK+ NQTLNE++FHKLTGGW
Sbjct: 648 WGIKCMMIQLQDENIVFSVQSADCKVVHEFIGGYIFMSMRSKENNQTLNEEMFHKLTGGW 707
|
|
| FB|FBgn0036688 Fit2 "Fermitin 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPF7 FERMT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C0T6 PLEKHC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96AC1 FERMT2 "Fermitin family homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3264 fermt1 "fermitin family member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB21 FERMT2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PFB4 FERMT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFE3 LOC100154173 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385001 Fermt2 "fermitin family homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| cd13205 | 89 | cd13205, FERM_C_fermitin, Fermitin family FERM dom | 1e-50 | |
| pfam00373 | 113 | pfam00373, FERM_M, FERM central domain | 6e-12 | |
| cd00836 | 91 | cd00836, FERM_C-lobe, FERM domain C-lobe | 2e-05 |
| >gnl|CDD|241359 cd13205, FERM_C_fermitin, Fermitin family FERM domain C-lobe | Back alignment and domain information |
|---|
Score = 157 bits (398), Expect = 1e-50
Identities = 54/89 (60%), Positives = 72/89 (80%)
Query: 69 GLTLFVIKPMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQL 128
G+T F+++ G KK+ELLGV +RL+RM+L +GD ++TWRY T+KAWNVNWEI+ +++Q
Sbjct: 1 GITYFIVRFRGSKKDELLGVAYNRLIRMDLHTGDVLKTWRYSTMKAWNVNWEIREVIIQF 60
Query: 129 TDGNFIFECQSADCKVVHEFIGGYIFLSM 157
D + F C SADCK+VHEFIGGYIFLSM
Sbjct: 61 EDESIAFACLSADCKIVHEFIGGYIFLSM 89
|
Fermitin functions as a mediator of integrin inside-out signalling. The recruitment of Fermitin proteins and Talin to the membrane mediates the terminal event of integrin signalling, via interaction with integrin beta subunits. Fermatin has FERM domain interrupted with a pleckstrin homology (PH) domain. Fermitin family homologs (Fermt1, 2, and 3, also known as Kindlins) are each encoded by a different gene. In mammalian studies, Fermt1 is generally expressed in epithelial cells, Fermt2 is expressed inmuscle tissues, and Fermt3 is expressed in hematopoietic lineages. Specifically Fermt2 is expressed in smooth and striated muscle tissues in mice and in the somites (a trunk muscle precursor) and neural crest in Xenopus embryos. As such it has been proposed that Fermt2 plays a role in cardiomyocyte and neural crest differentiation. Expression of mammalian Fermt3 is associated with hematopoietic lineages: the anterior ventral blood islands, vitelline veins, and early myeloid cells. In Xenopus embryos this expression, also include the notochord and cement gland. The FERM domain has a cloverleaf tripart structure (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe, B-lobe, C-lobe/F1, F2, F3). This cd is not included in the C-lobe hierarchy based on its position in the tree. One thing to note is that unlike the other members of the C-lobe hierarchy it contains 2 FERM M domains which might also reflect a difference in its evolutionary history. The C-lobe/F3 within the FERM domain is part of the PH domain family. The FERM domain is found in the cytoskeletal-associated proteins such as ezrin, moesin, radixin, 4.1R, and merlin. These proteins provide a link between the membrane and cytoskeleton and are involved in signal transduction pathways. The FERM domain is also found in protein tyrosine phosphatases (PTPs) , the tyrosine kinases FAK and JAK, in addition to other proteins involved in signaling. This domain is structurally similar to the PH and PTB domains and consequently is capable of binding to both peptides and phospholipids at different sites. Length = 89 |
| >gnl|CDD|215882 pfam00373, FERM_M, FERM central domain | Back alignment and domain information |
|---|
| >gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| KOG3727|consensus | 664 | 100.0 | ||
| KOG4261|consensus | 1003 | 99.96 | ||
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 99.31 | |
| KOG3529|consensus | 596 | 99.29 | ||
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 99.07 | |
| cd00836 | 92 | FERM_C FERM_C domain. The FERM_C domain is the thi | 98.9 | |
| KOG3530|consensus | 616 | 98.63 | ||
| KOG0248|consensus | 936 | 98.59 | ||
| PF02174 | 100 | IRS: PTB domain (IRS-1 type); InterPro: IPR002404 | 98.39 | |
| cd00824 | 104 | PTBI IRS-like phosphotyrosine-binding domain. IRS- | 98.17 | |
| cd01203 | 104 | DOK_PTB Downstream of tyrosine kinase (DOK) Phosph | 98.08 | |
| KOG3552|consensus | 1298 | 98.0 | ||
| smart00310 | 98 | PTBI Phosphotyrosine-binding domain (IRS1-like). | 97.94 | |
| KOG0792|consensus | 1144 | 97.9 | ||
| PF09380 | 90 | FERM_C: FERM C-terminal PH-like domain; InterPro: | 97.6 | |
| cd01202 | 102 | FRS2 Fibroblast growth factor receptor substrate 2 | 97.32 | |
| KOG4257|consensus | 974 | 97.29 | ||
| cd01216 | 123 | Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph | 96.98 | |
| PF00640 | 140 | PID: Phosphotyrosine interaction domain (PTB/PID) | 96.8 | |
| KOG3527|consensus | 975 | 96.77 | ||
| cd01268 | 138 | Numb Numb Phosphotyrosine-binding (PTB) domain. Nu | 96.66 | |
| KOG4261|consensus | 1003 | 96.65 | ||
| cd00934 | 123 | PTB Phosphotyrosine-binding (PTB) domain. Phosphot | 96.63 | |
| KOG4371|consensus | 1332 | 96.49 | ||
| cd01267 | 132 | CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, | 95.92 | |
| cd01272 | 138 | FE65_N Fe65 Phosphotyrosine-binding (PTB) domain. | 95.85 | |
| cd01269 | 129 | PLX Pollux (PLX) Phosphotyrosine-binding (PTB) dom | 95.41 | |
| cd00435 | 85 | ACBP Acyl CoA binding protein (ACBP) binds thiol e | 95.35 | |
| KOG3784|consensus | 407 | 95.15 | ||
| PF08416 | 131 | PTB: Phosphotyrosine-binding domain; InterPro: IPR | 95.08 | |
| smart00462 | 134 | PTB Phosphotyrosine-binding domain, phosphotyrosin | 94.83 | |
| cd01215 | 139 | Dab Disabled (Dab) Phosphotyrosine-binding domain. | 93.05 | |
| cd01274 | 127 | AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma | 92.88 | |
| PF00887 | 87 | ACBP: Acyl CoA binding protein; InterPro: IPR00058 | 92.44 | |
| PTZ00458 | 90 | acyl CoA binding protein; Provisional | 92.11 | |
| cd01273 | 142 | CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. | 91.4 | |
| KOG3535|consensus | 557 | 90.82 | ||
| cd01208 | 156 | X11 X11 Phosphotyrosine-binding (PTB) domain. X11 | 89.44 | |
| cd01210 | 127 | EPS8 Epidermal growth factor receptor kinase subst | 87.39 | |
| PF06017 | 199 | Myosin_TH1: Myosin tail; InterPro: IPR010926 These | 87.01 | |
| cd01209 | 160 | SHC SHC phosphotyrosine-binding (PTB) domain. SHC | 85.09 | |
| PF14470 | 96 | bPH_3: Bacterial PH domain | 82.01 |
| >KOG3727|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-53 Score=377.08 Aligned_cols=178 Identities=61% Similarity=1.102 Sum_probs=171.8
Q ss_pred CCCCCCC-C--CCCCCcccccccccCChHHHHHhhhH-HHHHHHHHHhccCCCChhHHHHHHHHHHhcCCCCceeEEEEe
Q psy14197 1 MQKPAPT-P--AISPASLDICAEDYVSSRYIKKLRSK-LSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIK 76 (178)
Q Consensus 1 ~q~~~~~-~--~~~~~~~~~~l~~~lP~~~ik~~~~k-~~~~I~~~h~~~~~ls~~eAK~~yLk~~~~lp~fG~tfF~Vk 76 (178)
||+++++ + +.+..|...++.+||.|++++++++| +.++|++||++++.||..|||++||++||+||.||+|+|.|+
T Consensus 481 MQ~~n~g~~q~~~~~~~~d~np~~~vSPr~~rk~ksKQ~~~RILEAHqNVaQlsl~EAKLrfIQAWQSLPeFGityfivR 560 (664)
T KOG3727|consen 481 MQRPNSGSRQAAPVKLPRDVNPECYVSPRYVRKLKSKQITQRILEAHQNVAQLSLTEAKLRFIQAWQSLPEFGITYFIVR 560 (664)
T ss_pred hcCCCCCCCcCCcccCcCCCCchhhcCHHHHHHHhhHHHHHHHHHHhhhHhhhhhHHHHHHHHHHHhhccccCcEEEEEE
Confidence 8999773 3 33456899999999999999999999 999999999999999999999999999999999999999999
Q ss_pred ecCCCCceEEEEcCCcEEEEeCCCCCeEEeeecccccccccccCCceEEEEecCC-CeEEEEecCCHHHHHHHHhhhhhH
Q psy14197 77 PMGHKKEELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDG-NFIFECQSADCKVVHEFIGGYIFL 155 (178)
Q Consensus 77 ~~g~~~p~lLGI~~~gv~~id~~tkeil~~~~~s~i~~w~~~~~~~~f~l~fg~~-~~~~~~~T~~~~~i~~Li~~Yi~l 155 (178)
++|.+|++||||+.+++++||..||+.++||+|+.|+.|+|||+.+.++|+|.++ ...|+|.+++|+.+||+|+||||+
T Consensus 561 FkGsrKeEllGVA~NRLirmDlatGd~iKTWRfsnMKqWNVNWeir~v~IeF~dev~iaFsc~SADCKVVHEfIGGYIFL 640 (664)
T KOG3727|consen 561 FKGSRKEELLGVAYNRLIRMDLATGDHIKTWRFSNMKQWNVNWEIRQVMIEFEDEVNIAFSCLSADCKVVHEFIGGYIFL 640 (664)
T ss_pred ecCcchHHHHhhhhhheeeeecccCCceeeeeecchhhhcccceeeEEEEEecccceEEEEeecccchhhhhhccceEEE
Confidence 9999999999999999999999999999999999999999999999999999999 599999999999999999999999
Q ss_pred hhhccccccccchhhhhhhcCCC
Q psy14197 156 SMRSKDANQTLNEDLFHKLTGGW 178 (178)
Q Consensus 156 ~~~~~~~~q~~~~~~f~~~~~~~ 178 (178)
+||+|+.||+|||||||||||||
T Consensus 641 StRsKd~netLDEeLFhKLTGGw 663 (664)
T KOG3727|consen 641 STRSKDQNETLDEELFHKLTGGW 663 (664)
T ss_pred EecchhccccccHHHHHhhccCC
Confidence 99999999999999999999999
|
|
| >KOG4261|consensus | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >KOG3529|consensus | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >cd00836 FERM_C FERM_C domain | Back alignment and domain information |
|---|
| >KOG3530|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >PF02174 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 Insulin receptor substrate-1 proteins contain both a pleckstrin homology domain IPR001849 from INTERPRO and a phosphotyrosine binding (PTB) domain | Back alignment and domain information |
|---|
| >cd00824 PTBI IRS-like phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >cd01203 DOK_PTB Downstream of tyrosine kinase (DOK) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >smart00310 PTBI Phosphotyrosine-binding domain (IRS1-like) | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >cd01202 FRS2 Fibroblast growth factor receptor substrate 2 (FRS2/SNT1) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains | Back alignment and domain information |
|---|
| >KOG3527|consensus | Back alignment and domain information |
|---|
| >cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG4261|consensus | Back alignment and domain information |
|---|
| >cd00934 PTB Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG4371|consensus | Back alignment and domain information |
|---|
| >cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >cd01272 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01269 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >KOG3784|consensus | Back alignment and domain information |
|---|
| >PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein | Back alignment and domain information |
|---|
| >smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain | Back alignment and domain information |
|---|
| >cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain | Back alignment and domain information |
|---|
| >cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] | Back alignment and domain information |
|---|
| >PTZ00458 acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
| >cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >KOG3535|consensus | Back alignment and domain information |
|---|
| >cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF06017 Myosin_TH1: Myosin tail; InterPro: IPR010926 These proteins share a region of sequence similarity with the tail of myosin (for example O00159 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd01209 SHC SHC phosphotyrosine-binding (PTB) domain | Back alignment and domain information |
|---|
| >PF14470 bPH_3: Bacterial PH domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 178 | ||||
| 3g9w_A | 223 | Crystal Structure Of Talin2 F2-f3 In Complex With T | 3e-10 | ||
| 1y19_B | 202 | Structural Basis For Phosphatidylinositol Phosphate | 3e-10 | ||
| 4f7g_A | 222 | Crystal Structure Of Talin Autoinhibition Complex L | 3e-10 | ||
| 1mk7_B | 192 | Crystal Structure Of An Integrin Beta3-Talin Chimer | 1e-09 | ||
| 3ivf_A | 371 | Crystal Structure Of The Talin Head Ferm Domain Len | 1e-09 | ||
| 1miz_B | 201 | Crystal Structure Of An Integrin Beta3-Talin Chimer | 1e-09 | ||
| 1mix_A | 206 | Crystal Structure Of A Ferm Domain Of Talin Length | 1e-09 |
| >pdb|3G9W|A Chain A, Crystal Structure Of Talin2 F2-f3 In Complex With The Integrin Beta1d Cytoplasmic Tail Length = 223 | Back alignment and structure |
|
| >pdb|1Y19|B Chain B, Structural Basis For Phosphatidylinositol Phosphate Kinase Type I-Gamma Binding To Talin At Focal Adhesions Length = 202 | Back alignment and structure |
| >pdb|4F7G|A Chain A, Crystal Structure Of Talin Autoinhibition Complex Length = 222 | Back alignment and structure |
| >pdb|1MK7|B Chain B, Crystal Structure Of An Integrin Beta3-Talin Chimera Length = 192 | Back alignment and structure |
| >pdb|3IVF|A Chain A, Crystal Structure Of The Talin Head Ferm Domain Length = 371 | Back alignment and structure |
| >pdb|1MIZ|B Chain B, Crystal Structure Of An Integrin Beta3-Talin Chimera Length = 201 | Back alignment and structure |
| >pdb|1MIX|A Chain A, Crystal Structure Of A Ferm Domain Of Talin Length = 206 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 178 | |||
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 2e-33 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 6e-30 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 4e-19 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 2e-12 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 7e-11 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 5e-07 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 8e-07 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 3e-06 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 4e-06 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 5e-06 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 8e-04 |
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 | Back alignment and structure |
|---|
Score = 117 bits (295), Expect = 2e-33
Identities = 37/148 (25%), Positives = 75/148 (50%), Gaps = 10/148 (6%)
Query: 20 EDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIKPMG 79
+D++ Y+K+ K ++I +AH N + EAK+ Y++ +SL YG++ F++K
Sbjct: 80 KDFLPKEYVKQ---KGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKM 136
Query: 80 HKK----EELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTD-GNFI 134
K LLG+T +MR++ + + ++ W +K W + K L D +
Sbjct: 137 KGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASP--KSFTLDFGDYQDGY 194
Query: 135 FECQSADCKVVHEFIGGYIFLSMRSKDA 162
+ Q+ + + + + I GYI + ++ K +
Sbjct: 195 YSVQTTEGEQIAQLIAGYIDIILKKKKS 222
|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 100.0 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 99.97 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 99.96 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 99.95 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 99.93 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 99.93 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 99.92 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 99.91 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 99.9 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 99.88 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 99.87 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 99.83 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.93 | |
| 1j0w_A | 103 | Downstream of tyrosine kinase 5; beta strands, ALF | 98.06 | |
| 2v76_A | 107 | Docking protein 1; alternative splicing, protein-b | 97.76 | |
| 1p5t_A | 127 | DOK1, docking protein 1; signaling protein; 2.35A | 97.75 | |
| 2dlw_A | 113 | Docking protein 2, isoform A; IRS domain, structur | 97.61 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 97.4 | |
| 2kup_A | 146 | Fibroblast growth factor receptor substrate 3; com | 97.37 | |
| 2kuq_A | 153 | Fibroblast growth factor receptor substrate 3, LI | 97.26 | |
| 1xr0_B | 129 | FGFR signalling adaptor SNT-1; phosphotyrosine bin | 97.26 | |
| 3d8d_A | 148 | Amyloid beta A4 precursor protein-binding family 1 | 97.25 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 96.77 | |
| 3f0w_A | 168 | NUMB-R, NUMB-like protein; PH domain-like, PID dom | 96.57 | |
| 1ntv_A | 152 | Disabled homolog 1; beta-sandwich, signaling prote | 95.94 | |
| 1aqc_A | 172 | X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 | 95.91 | |
| 3so6_A | 137 | LDL receptor adaptor protein; PTB, endocytic adapt | 95.22 | |
| 2ej8_A | 160 | DCC-interacting protein 13 alpha; structural genom | 95.2 | |
| 1p3r_A | 160 | Disabled homolog 2; PTB, signaling protein; 2.10A | 94.9 | |
| 2ela_A | 175 | Adapter protein containing PH domain, PTB domain a | 94.7 | |
| 4dbb_A | 162 | Amyloid beta A4 precursor protein-binding family 1 | 94.7 | |
| 2cy5_A | 140 | Epidermal growth factor receptor pathway substrate | 94.47 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 93.5 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 93.17 | |
| 1n3h_A | 207 | SHC transforming protein; free protein, beta sandw | 93.02 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 92.87 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 92.52 | |
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 92.41 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 92.25 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 91.92 | |
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 90.84 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 90.79 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 90.27 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 85.77 | |
| 3dxe_A | 140 | Amyloid beta A4 protein-binding family B member 1; | 84.89 |
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-32 Score=223.61 Aligned_cols=143 Identities=25% Similarity=0.503 Sum_probs=128.4
Q ss_pred cccccccccCChHHHHHhhhHHHHHHHHHHhccCCCChhHHHHHHHHHHhcCCCCceeEEEEeecC--CC--CceEEEEc
Q psy14197 14 SLDICAEDYVSSRYIKKLRSKLSQRILEAHANVKDLGLTEAKLSYIRAWQSLPDYGLTLFVIKPMG--HK--KEELLGVT 89 (178)
Q Consensus 14 ~~~~~l~~~lP~~~ik~~~~k~~~~I~~~h~~~~~ls~~eAK~~yLk~~~~lp~fG~tfF~Vk~~g--~~--~p~lLGI~ 89 (178)
+++..++.|+|+++++. .|+++|.++|+++.|+|+.|||++||++|++||+||++||.|+.+. .+ .|.+||||
T Consensus 74 ~~~~~l~~~lP~~~~~~---~~~~~I~~~h~~~~g~s~~eA~~~yL~~~~~l~~yG~~~f~v~~~~~g~~~~~~~~LgI~ 150 (222)
T 4f7g_A 74 AGFLDLKDFLPKEYVKQ---KGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGIT 150 (222)
T ss_dssp SSCSCGGGTSCGGGGGG---CCHHHHHHHHHTTTTCCHHHHHHHHHHHHHTSTTTTCEEEEEEEECTTSSCEEEEEEEEC
T ss_pred cCccchhhccCHHHHhh---hhHHHHHHHHHhccCCCHHHHHHHHHHHHhhccccCcEEEEEEEecCCCCCCCCEEEEEc
Confidence 56789999999999873 3689999999999999999999999999999999999999999863 33 37899999
Q ss_pred CCcEEEEeCCCCCeEEeeecccccccccccCCceEEEEecCC-CeEEEEecCCHHHHHHHHhhhhhHhhhccc
Q psy14197 90 PSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDG-NFIFECQSADCKVVHEFIGGYIFLSMRSKD 161 (178)
Q Consensus 90 ~~gv~~id~~tkeil~~~~~s~i~~w~~~~~~~~f~l~fg~~-~~~~~~~T~~~~~i~~Li~~Yi~l~~~~~~ 161 (178)
++||.++|++|++++.+|||++|.+|+.+. +.|+|.+++. +..|.|+|+++++|++||+|||++++++|+
T Consensus 151 ~~GI~v~~~~tk~~l~~~~~~~I~~~~~~~--~~f~I~~~~~~~~~~~~~T~q~~~I~~Li~~Yi~~~~~~r~ 221 (222)
T 4f7g_A 151 KECVMRVDEKTKEVIQEWSLTNIKRWAASP--KSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKK 221 (222)
T ss_dssp SSEEEEECTTTCCEEEEEEGGGCCEEEECS--SEEEEECCTTSSSCEEEECSCHHHHHHHHHHHHHHTC----
T ss_pred CCcEEEEcCCCCceeEeccHHHeeeeccCC--CEEEEEECCccceEEEEECCcHHHHHHHHHHHHHHHHHhhc
Confidence 999999999999999999999999999887 8999999987 567999999999999999999999999876
|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >1j0w_A Downstream of tyrosine kinase 5; beta strands, ALFA helix, transferase; 2.50A {Homo sapiens} SCOP: b.55.1.2 | Back alignment and structure |
|---|
| >2v76_A Docking protein 1; alternative splicing, protein-binding, PTB domain, phosphorylation, adaptor protein; HET: PGE; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5t_A DOK1, docking protein 1; signaling protein; 2.35A {Mus musculus} SCOP: b.55.1.2 PDB: 1uef_A* | Back alignment and structure |
|---|
| >2dlw_A Docking protein 2, isoform A; IRS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2kup_A Fibroblast growth factor receptor substrate 3; complex, SNT-2, PTB domain, HALK, structural genomics, signa protein, NPPSFA; NMR {Homo sapiens} PDB: 2ys5_A | Back alignment and structure |
|---|
| >2kuq_A Fibroblast growth factor receptor substrate 3, LI residue peptide from ALK tyrosine...; chimera, SNT-2, PTB domain, HALK, structural genomics; NMR {Homo sapiens} PDB: 2yt2_A | Back alignment and structure |
|---|
| >1xr0_B FGFR signalling adaptor SNT-1; phosphotyrosine binding domain, PTB, TRK, NPXPY motif,, signaling protein/growth factor receptor complex; NMR {Homo sapiens} SCOP: b.55.1.2 | Back alignment and structure |
|---|
| >3d8d_A Amyloid beta A4 precursor protein-binding family 1; alpha-beta structure, phosphotyrosine binding domain; 2.20A {Homo sapiens} PDB: 3d8e_A 3d8f_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A | Back alignment and structure |
|---|
| >1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* | Back alignment and structure |
|---|
| >1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* | Back alignment and structure |
|---|
| >3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A | Back alignment and structure |
|---|
| >2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cy5_A Epidermal growth factor receptor pathway substrate 8-like protein 1; structural genomics, signal transduction, phosphorylation, PTB domain, NPPSFA; 1.90A {Mus musculus} SCOP: b.55.1.2 PDB: 2cy4_A | Back alignment and structure |
|---|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A | Back alignment and structure |
|---|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} SCOP: b.55.1.0 PDB: 3dxd_A 3dxc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 178 | ||||
| d1mixa2 | 92 | b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus | 9e-05 |
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 92 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Third domain of FERM domain: Talin species: Chicken (Gallus gallus) [TaxId: 9031]
Score = 37.5 bits (87), Expect = 9e-05
Identities = 17/88 (19%), Positives = 40/88 (45%), Gaps = 7/88 (7%)
Query: 69 GLTLFVIKPM--GHKKEE--LLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHM 124
G++ F++K G K LLG+T +MR++ + + ++ W +K W + + +
Sbjct: 1 GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTL 60
Query: 125 ML-QLTDGNFIFECQSAD--CKVVHEFI 149
DG + + + +++ +I
Sbjct: 61 DFGDYQDGYYSVQTTEGEQIAQLIAGYI 88
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 178 | |||
| d1mixa2 | 92 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.87 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 99.16 | |
| d1j0wa_ | 99 | Downstream of tyrosine kinase 5, Dok-5 {Human (Hom | 99.08 | |
| d1xr0b_ | 129 | FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [Ta | 99.06 | |
| d1h4ra2 | 99 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.79 | |
| d1ef1a2 | 99 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.75 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 98.64 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 98.61 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 98.58 | |
| d1gg3a2 | 92 | Erythroid membrane protein 4.1R {Human (Homo sapie | 97.94 | |
| d1p5ta_ | 107 | Docking protein 1, Dok1 {Mouse (Mus musculus) [Tax | 97.89 | |
| d1qqga2 | 104 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 97.66 | |
| d1wj1a_ | 156 | Numb {Mouse (Mus musculus) [TaxId: 10090]} | 97.04 | |
| d2cy5a1 | 129 | EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) | 96.87 | |
| d1ntva_ | 152 | Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T | 96.55 | |
| d1p3ra_ | 148 | Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T | 96.13 | |
| d1aqca_ | 166 | X11 {Human (Homo sapiens) [TaxId: 9606]} | 94.8 | |
| d1hb6a_ | 86 | Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: | 94.66 | |
| d1ddma_ | 135 | Numb {Fruit fly (Drosophila melanogaster) [TaxId: | 94.56 | |
| d2al6a2 | 110 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 92.94 | |
| d1wgua_ | 136 | Amyloid beta A4 precursor protein-binding family B | 92.74 | |
| d1hbka_ | 89 | Acyl-CoA binding protein {Plasmodium falciparum [T | 92.69 | |
| d2dkqa1 | 147 | Tensin {Human (Homo sapiens) [TaxId: 9606]} | 90.92 | |
| d1oy2a_ | 191 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 90.57 | |
| d1wvha1 | 133 | Tensin {Chicken (Gallus gallus) [TaxId: 9031]} | 89.3 |
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Third domain of FERM domain: Talin species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.87 E-value=1.1e-22 Score=143.10 Aligned_cols=87 Identities=24% Similarity=0.527 Sum_probs=79.3
Q ss_pred ceeEEEEeecCC--CC--ceEEEEcCCcEEEEeCCCCCeEEeeecccccccccccCCceEEEEecCC-CeEEEEecCCHH
Q psy14197 69 GLTLFVIKPMGH--KK--EELLGVTPSRLMRMELSSGDHVRTWRYDTVKAWNVNWEIKHMMLQLTDG-NFIFECQSADCK 143 (178)
Q Consensus 69 G~tfF~Vk~~g~--~~--p~lLGI~~~gv~~id~~tkeil~~~~~s~i~~w~~~~~~~~f~l~fg~~-~~~~~~~T~~~~ 143 (178)
|++||.||++.. .+ |++||||++||.++|++|++++.+|||+.|++|..+. +.|++++|+. +..|.++|++++
T Consensus 1 G~~fF~vk~~~~~~~~~~~~lLav~~~gv~lld~~t~~~l~~~py~~Ir~~g~~~--~~F~~~~G~~~~g~~~f~T~q~~ 78 (92)
T d1mixa2 1 GVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASP--KSFTLDFGDYQDGYYSVQTTEGE 78 (92)
T ss_dssp TCEEEEEEECCSSCSSCEEEEEEECSSEEEEEETTTCCEEEEEEGGGCCEEEECS--SEEEEECGGGSSSCEEEECSCHH
T ss_pred CCceEEEEEEecCCCCCCCEEEEECcceEEEEcCCCCceEEEcchhheeeccCCC--CEEEEEECCCcceEEEEEeCCHH
Confidence 899999998743 22 6799999999999999999999999999999999877 8899999987 567889999999
Q ss_pred HHHHHHhhhhhHhh
Q psy14197 144 VVHEFIGGYIFLSM 157 (178)
Q Consensus 144 ~i~~Li~~Yi~l~~ 157 (178)
+|.+||++||++++
T Consensus 79 eI~~li~~yI~~i~ 92 (92)
T d1mixa2 79 QIAQLIAGYIDIIL 92 (92)
T ss_dssp HHHHHHHTTSCCCC
T ss_pred HHHHHHHHHHHHhC
Confidence 99999999999875
|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xr0b_ b.55.1.2 (B:) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5ta_ b.55.1.2 (A:) Docking protein 1, Dok1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qqga2 b.55.1.2 (A:159-262) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2al6a2 b.55.1.5 (A:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|