Diaphorina citri psyllid: psy1420

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-

MKLPMYEVFENVAKSYDTMNDAMSFGIHRLWKDIFIDRLGPTHDTKLLDVAGGTDPLANLLFVLRAYDQYSFQVIPVMGQLIAGQWKPYQYLVESIRQFPNQIDIPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKIDIPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKALSEAYRVLKPGGRFLCLEFSHEEFKSMIESAGFQYVTYENLTFGVVAIHSGFKL

cccHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHcccccccEEEECccccHHHHHHHHHHHHcccccccccccccEEEEEEccHHHHHHHHHcccccccccccccEEEEEccccccccccccccEEEEEcccccccccccccccccEEEEEEccccccHHHHHHHHHHccccccccccHHHcccccccccccccHHHccccccHHHHHHHHHHcccccccEEEccccEEEEEEEEEc

**LPMYEVFENVAKSYDTMNDAMSFGIHRLWKDIFIDRLGPTHDTKLLDVAGGTDPLANLLFVLRAYDQYSFQVIPVMGQLIAGQWKPYQYLVESIRQFPNQIDIPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKIDIPNPRLRFLEANAEELPIESDSYSAYTIAFGIRNVTRIDKALSEAYRVLKPGGRFLCLEFSHEEFKSMIESAGFQYVTYENLTFGVVAIHSGFKL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE	Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	confident	Q8UIH5
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE	Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	confident	Q92SK7
Ubiquinone/menaquinone biosynthesis methyltransferase ubiE	Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2) and the conversion of 2-polyprenyl-6-methoxy-1,4-benzoquinol (DDMQH2) to 2-polyprenyl-3-methyl-6-methoxy-1,4-benzoquinol (DMQH2).	confident	Q1I3T0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005759 [CC]	mitochondrial matrix	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0043333 [MF]	2-octaprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity	probable	GO:0030580, GO:0008425, GO:0003824, GO:0016740, GO:0016741, GO:0003674, GO:0008169, GO:0008168
GO:0070887 [BP]	cellular response to chemical stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0006744 [BP]	ubiquinone biosynthetic process	probable	GO:0006732, GO:0006733, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0045426, GO:1901576, GO:0044710, GO:0051186, GO:1901663, GO:0051188, GO:1901661, GO:0042375, GO:0071704, GO:0006743, GO:0009987, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0042181, GO:0042180, GO:0044237
GO:0009234 [BP]	menaquinone biosynthetic process	probable	GO:1901576, GO:0044710, GO:0044711, GO:0042181, GO:0042180, GO:0071704, GO:0044237, GO:0009987, GO:1901663, GO:0009233, GO:1901661, GO:0044249, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AVN, chain A
Confidence level:very confident
Coverage over the Query: 2-58,72-76,96-118,150-208
View the alignment between query and template
View the model in PyMOL

Template: 1XXL, chain A
Confidence level:very confident
Coverage over the Query: 35-58,72-76,96-118,144-229
View the alignment between query and template
View the model in PyMOL

Template: 2A14, chain A
Confidence level:confident
Coverage over the Query: 40-58,72-76,95-241
View the alignment between query and template
View the model in PyMOL