Diaphorina citri psyllid: psy14210

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MFITGTTTLGFRYPEGIILATDSRATANDLIVSQKLNKFCQSSLGDSCELLHPVYTGGERCGQSYSQRSHCVAETQQDHFLSPPLSQSSQHIISGDSCELLHPVYTGGERCGPFSQSSTVPHNTSFQVIPVSSSILCTLAGNAADCVYWLHSLAKECKGYECKYRTGMTIRHAANLLVNMVRKYRTGNHSSKIPNGLSFGTLMAAYDEILGPQLYMLDNTGLLIEGTKFCVGSGAEYAQAILDTDYRPDLSEEEAYALATSAIYHACRRDIHSGGCVRLYKINGQGWQQVLSRDVKDIYNDRKEAPPGGGDH
cccccccEEEEEEcccEEEEEccccccccEEEccccccEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccCEEEEEcccccEEccccccEEEEEccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccCEEEEEEEEEcccccEEEEEcccccEEEccEEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEccccHHHHHHHHcccccccccc
*FITGTTTLGFRYPEGIILATDSRATANDLIVSQKLNKFCQSSLGDSCELLHPVYTGGERCGQSYSQRSHCVAETQQDHFL*******SQHIISGDSCELLHPVYTGGERCGPFSQSSTVPHNTSFQVIPVSSSILCTLAGNAADCVYWLHSLAKECKGYECKYRTGMTIRHAANLLVNMVRKYRTGNHSSKIPNGLSFGTLMAAYDEILGPQLYMLDNTGLLIEGTKFCVGSGAEYAQAILDTDYRPDLSEEEAYALATSAIYHACRRDIHSGGCVRLYKINGQGWQQVLSRDVKDIYN************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFITGTTTLGFRYPEGIILATDSRATANDLIVSQKLNKFCQSSLGDSCELLHPVYTGGERCGQSYSQRSHCVAETQQDHFLSPPLSQSSQHIISGDSCELLHPVYTGGERCGPFSQSSTVPHNTSFQVIPVSSSILCTLAGNAADCVYWLHSLAKECKGYECKYRTGMTIRHAANLLVNMVRKYRTGNHSSKIPNGLSFGTLMAAYDEILGPQLYMLDNTGLLIEGTKFCVGSGAEYAQAILDTDYRPDLSEEEAYALATSAIYHACRRDIHSGGCVRLYKINGQGWQQVLSRDVKDIYNDRKEAPPGGGDH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Proteasome subunit beta type-5 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib (By similarity). Plays a role in the protection against oxidative damage through the Nrf2-ARE pathway.confidentO55234
Proteasome subunit beta type-5 The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.confidentQ54BC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005839 [CC]proteasome core complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0000502
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.25.-Threonine endopeptidases.probable
3.4.25.1Transferred entry: 3.4.25.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRU, chain L
Confidence level:very confident
Coverage over the Query: 6-38,128-304
View the alignment between query and template
View the model in PyMOL
Template: 3UNB, chain K
Confidence level:confident
Coverage over the Query: 99-300
View the alignment between query and template
View the model in PyMOL