Diaphorina citri psyllid: psy14221

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
cccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcEEccEEEEcccccHHHHHHHHHHHHHHHHHcccc
*WKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043227 [CC]membrane-bounded organelleprobableGO:0005575, GO:0043226
GO:0051179 [BP]localizationprobableGO:0008150
GO:0043256 [CC]laminin complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 7-54,73-136,154-237
View the alignment between query and template
View the model in PyMOL
Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 171-251,266-288,304-375
View the alignment between query and template
View the model in PyMOL
Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 342-483
View the alignment between query and template
View the model in PyMOL
Template: 3T5O, chain A
Confidence level:probable
Coverage over the Query: 112-163,177-199,210-274,286-485
View the alignment between query and template
View the model in PyMOL