Psyllid ID: psy14221

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540------
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
cccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcEEccEEEEcccccHHHHHHHHHHHHHHHHHcccc
cccccccccEEEEccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccEEEccccccccccHccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccEEcccccccc
MWKAGSVINVDLvhssnvegrqcdqcrpgsfslsadnlagctpcfcfnrsthcteagqytgnrigsyslnlefSVSWIVMrgdtsgiptqvpdIILIMRvrepgytgplcdrcaygyfgfpsqpngscepcncspygsvsdecheesgqcncrigitgrdcsqceprhiltsrgcascedgyigdhcescdagyygnptelggscvpcscgggpcdastgecvqcrgntegarcerckplyygdprtgdckpcecntsgslgdecdsisgqcqckenragrtcnlaldcppcdcdplgtlsvpqpchpvsgtcycqpgvtgdrcdqcdtgywnftvngctscncnrdgslhfscdvhtgqcsckpnmtglacdqcteghwglqelgcascecnavgsvnnscdqitgqcvcrkgvtgrtcdkcrpdyfgfsvngctecasceqsgmvcseesgqcvcppltrgdlciqcapnsygyrpllgcqpcrcdlrgsmraqgivtVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
mwkagsvinVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDtsgiptqvpDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCrgntegarcerckplyygdprtgdcKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELggscvpcscgggpcDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
******VINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDN***
*WKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNV**
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYG***********QCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASC************QCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
****GSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWKAGSVINVDLVHSSNVEGRQCDQCRPGSFSLSADNLAGCTPCFCFNRSTHCTEAGQYTGNRIGSYSLNLEFSVSWIVMRGDTSGIPTQVPDIILIMRVREPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDASTGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQGIVTVDLAILDIYVINVLLDITVILSVNIASVTWQVACHLYAIVRDNVLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query546 2.2.26 [Sep-21-2011]
P19137 3084 Laminin subunit alpha-1 O yes N/A 0.683 0.120 0.360 4e-55
P25391 3075 Laminin subunit alpha-1 O yes N/A 0.752 0.133 0.343 1e-54
Q60675 3106 Laminin subunit alpha-2 O no N/A 0.695 0.122 0.339 4e-52
P24043 3122 Laminin subunit alpha-2 O no N/A 0.684 0.119 0.340 1e-51
Q21313 3672 Laminin-like protein epi- no N/A 0.652 0.096 0.361 3e-49
Q8JHV6 1827 Laminin subunit beta-4 OS no N/A 0.613 0.183 0.372 2e-47
Q61001 3718 Laminin subunit alpha-5 O no N/A 0.672 0.098 0.346 1e-46
O15230 3695 Laminin subunit alpha-5 O no N/A 0.659 0.097 0.347 1e-45
P11046 1788 Laminin subunit beta-1 OS no N/A 0.747 0.228 0.321 3e-45
O75445 5202 Usherin OS=Homo sapiens G no N/A 0.646 0.067 0.339 2e-43
>sp|P19137|LAMA1_MOUSE Laminin subunit alpha-1 OS=Mus musculus GN=Lama1 PE=1 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 161/447 (36%), Positives = 218/447 (48%), Gaps = 74/447 (16%)

Query: 106  TGPLCDRCAYGYFGFPSQPN-GSCEPCNCS---PYGSVSDECHEESGQCNCRIGITGRDC 161
            TG  C++C  G++G PS+   G C+PC C       + S  CH   G+           C
Sbjct: 772  TGDHCEQCLPGFYGTPSRGTPGDCQPCACPLSIDSNNFSPTCHLTDGEEVV--------C 823

Query: 162  SQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGG-------GP 214
             QC P              GY G  CE C  GYYGNPT  GG+CVPC+C G       G 
Sbjct: 824  DQCAP--------------GYSGSWCERCADGYYGNPTVPGGTCVPCNCSGNVDPLEAGH 869

Query: 215  CDASTGECVQCRGNTEGARCERCKPLYYGDPRTG-DCKPCECNTSGSLGDECDSISGQCQ 273
            CD+ TGEC++C  NT+GA CERC   +YGD  T  +C+ C+C+ +GSL   C   +G C 
Sbjct: 870  CDSVTGECLKCLWNTDGAHCERCADGFYGDAVTAKNCRACDCHENGSLSGVCHLETGLCD 929

Query: 274  CKENRAGRTC----------NLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDR 323
            CK +  G+ C          +  L C PC+C   G  SV   C    G C+C PGV+G +
Sbjct: 930  CKPHVTGQQCDQCLSGYYGLDTGLGCVPCNCSVEG--SVSDNCTE-EGQCHCGPGVSGKQ 986

Query: 324  CDQCDTGYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQ 383
            CD+C  G++ F   GCT C+C        +CD  +G+C C P+  GL C++C E +WGL 
Sbjct: 987  CDRCSHGFYAFQDGGCTPCDC---AHTQNNCDPASGECLCPPHTQGLKCEECEEAYWGLD 1043

Query: 384  -ELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECA--- 439
             E GC +C C+AVGS +  CD ++G C C+KG  G++C +C   Y  F    C  C    
Sbjct: 1044 PEQGCQACNCSAVGSTSAQCDVLSGHCPCKKGFGGQSCHQCSLGYRSFP--DCVPCGCDL 1101

Query: 440  --------SCEQSGMVCSEESGQCVCPPLTRGDLCIQCAPNSYGYR--PLLGCQPCRC-- 487
                      EQ    CSE+SG C C     G  C +C   ++  R     GC PC C  
Sbjct: 1102 RGTLPDTCDLEQGLCSCSEDSGTCSCKENVVGPQCSKCQAGTFALRGDNPQGCSPCFCFG 1161

Query: 488  ------DLRGSMRAQGIVTVDLAILDI 508
                  +L G +R    +  D  +L +
Sbjct: 1162 LSQLCSELEGYVRTLITLASDQPLLHV 1188
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Mus musculus (taxid: 10090)
>sp|P25391|LAMA1_HUMAN Laminin subunit alpha-1 OS=Homo sapiens GN=LAMA1 PE=1 SV=2 Back     alignment and function description
>sp|Q60675|LAMA2_MOUSE Laminin subunit alpha-2 OS=Mus musculus GN=Lama2 PE=1 SV=1 Back     alignment and function description
>sp|P24043|LAMA2_HUMAN Laminin subunit alpha-2 OS=Homo sapiens GN=LAMA2 PE=1 SV=4 Back     alignment and function description
>sp|Q21313|EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans GN=epi-1 PE=1 SV=1 Back     alignment and function description
>sp|Q8JHV6|LAMB4_DANRE Laminin subunit beta-4 OS=Danio rerio GN=lamb4 PE=2 SV=1 Back     alignment and function description
>sp|Q61001|LAMA5_MOUSE Laminin subunit alpha-5 OS=Mus musculus GN=Lama5 PE=1 SV=4 Back     alignment and function description
>sp|O15230|LAMA5_HUMAN Laminin subunit alpha-5 OS=Homo sapiens GN=LAMA5 PE=1 SV=8 Back     alignment and function description
>sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster GN=LanB1 PE=1 SV=4 Back     alignment and function description
>sp|O75445|USH2A_HUMAN Usherin OS=Homo sapiens GN=USH2A PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
340709274 3145 PREDICTED: laminin subunit alpha-1-like 0.683 0.118 0.448 1e-83
350425118 3144 PREDICTED: laminin subunit alpha-1-like 0.683 0.118 0.448 2e-83
328700493 3098 PREDICTED: laminin subunit alpha-1-like 0.710 0.125 0.414 9e-81
345480466 3201 PREDICTED: LOW QUALITY PROTEIN: laminin 0.675 0.115 0.419 2e-77
386769627 3001 wing blister, isoform G [Drosophila mela 0.694 0.126 0.406 2e-77
24584296 3375 wing blister, isoform B [Drosophila mela 0.694 0.112 0.406 3e-77
4883938 3367 laminin alpha1,2 [Drosophila melanogaste 0.694 0.112 0.406 4e-77
405973367 3502 Laminin subunit alpha-2 [Crassostrea gig 0.684 0.106 0.425 5e-77
195338403 2682 GM15516 [Drosophila sechellia] gi|194129 0.694 0.141 0.404 5e-77
195397806 3383 GJ18176 [Drosophila virilis] gi|19414117 0.695 0.112 0.402 8e-76
>gi|340709274|ref|XP_003393236.1| PREDICTED: laminin subunit alpha-1-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  317 bits (812), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 183/408 (44%), Positives = 234/408 (57%), Gaps = 35/408 (8%)

Query: 102  EPGYTGPLCDRCAYGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRD- 160
            E    GP CDRCA G++G   +                SD+C     +C C + I   + 
Sbjct: 705  EHNTVGPKCDRCAPGFYGIALK--------------GTSDDCK----RCACPLLIETNNF 746

Query: 161  ---CSQCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPTELGGSCVPCSCGGGPCDA 217
               C   +P  I +   C  C  GY GDHCESCD G++GNP   GG+C PC CGGGPCD 
Sbjct: 747  SPNCQLDDPTDIDSGYVCTQCPKGYTGDHCESCDIGFFGNPLIPGGTCEPCFCGGGPCDQ 806

Query: 218  STGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKEN 277
             TG C++CRGNTEG +C++CKP +YG+P   +C PC C+  G+   ECD  SGQC CK  
Sbjct: 807  ETGRCLECRGNTEGWKCDKCKPAHYGNPLEQNCLPCNCDPLGTSSIECDEKSGQCPCKPL 866

Query: 278  RAGRTC--------NLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDT 329
              GR C        N+   C  CDCD +G L   + C PV+G C C  GV G RCD CD 
Sbjct: 867  FEGRDCSSCIEGYGNVTAGCRECDCD-VGALD--EICDPVTGECRCTEGVLGFRCDHCDI 923

Query: 330  GYWNFTVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQE-LGCA 388
             ++  +  GC  C CN  GS+  +CD+ TGQC CKP++TG  CDQC  G WGL    GCA
Sbjct: 924  DHYGLSTEGCKGCRCNPIGSITTACDIVTGQCQCKPHVTGRQCDQCMIGFWGLPTGAGCA 983

Query: 389  SCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMVC 448
             C C+ +G+ N+SC    GQC C+ GV G  CD C P Y+G+S NGC  C SC + G VC
Sbjct: 984  PCGCDPIGAYNSSCHDSIGQCYCKPGVGGTRCDVCLPGYYGYSSNGCQVCDSCVRPGHVC 1043

Query: 449  SEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGSMRAQ 496
              ++G+CVCP LT G+ C +C   S+   P +GC+PC C L GSM+ Q
Sbjct: 1044 DPDTGRCVCPTLTFGEHCDRCRSGSWDLVPGVGCRPCACTL-GSMKPQ 1090

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350425118|ref|XP_003494017.1| PREDICTED: laminin subunit alpha-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328700493|ref|XP_001950530.2| PREDICTED: laminin subunit alpha-1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345480466|ref|XP_003424155.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit alpha-2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|386769627|ref|NP_476790.3| wing blister, isoform G [Drosophila melanogaster] gi|383291494|gb|AAF53381.3| wing blister, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584296|ref|NP_723870.1| wing blister, isoform B [Drosophila melanogaster] gi|22946483|gb|AAN10875.1| wing blister, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|4883938|gb|AAD31714.1|AF135118_1 laminin alpha1,2 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|405973367|gb|EKC38085.1| Laminin subunit alpha-2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|195338403|ref|XP_002035814.1| GM15516 [Drosophila sechellia] gi|194129694|gb|EDW51737.1| GM15516 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195397806|ref|XP_002057519.1| GJ18176 [Drosophila virilis] gi|194141173|gb|EDW57592.1| GJ18176 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query546
WB|WBGene00002248 3102 lam-3 [Caenorhabditis elegans 0.683 0.120 0.375 7.3e-89
ZFIN|ZDB-GENE-060118-1 3075 lama1 "laminin, alpha 1" [Dani 0.653 0.116 0.371 6.4e-81
UNIPROTKB|F1MEG3 3031 LAMA1 "Uncharacterized protein 0.684 0.123 0.357 2.9e-79
MGI|MGI:99892 3084 Lama1 "laminin, alpha 1" [Mus 0.673 0.119 0.348 5.8e-79
RGD|1307207 3083 Lama1 "laminin, alpha 1" [Ratt 0.650 0.115 0.354 6.2e-78
UNIPROTKB|P25391 3075 LAMA1 "Laminin subunit alpha-1 0.653 0.116 0.355 1.3e-77
UNIPROTKB|F1N8P9 3060 LAMA1 "Uncharacterized protein 0.653 0.116 0.348 1.6e-77
UNIPROTKB|F1NM47 3061 LAMA1 "Uncharacterized protein 0.653 0.116 0.348 1.6e-77
UNIPROTKB|F1MMT2 3085 LAMA2 "Uncharacterized protein 0.723 0.128 0.339 9.5e-69
UNIPROTKB|F1PEZ5 3085 LAMA2 "Uncharacterized protein 0.750 0.132 0.331 2.3e-74
WB|WBGene00002248 lam-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 805 (288.4 bits), Expect = 7.3e-89, Sum P(2) = 7.3e-89
 Identities = 152/405 (37%), Positives = 216/405 (53%)

Query:   106 TGPLCDRCAYGYFGFPSQPN--GSCEPCNCSPYG-SVSDECHEESGQCNCRIGITGRDCS 162
             TG  C+ C  G+ G PS+    G+CE C C     + + EC       +  + + G   S
Sbjct:   798 TGSRCELCKPGHVGNPSRGGELGACEQCECPSLDLNPNPEC------ISTELAVLGSVAS 851

Query:   163 QCEPRHILTSRGCASCEDGYIGDHCESCDAGYYGNPT-----ELXXXXXXXXXXXXXXDA 217
               E  ++     C +C  GY G+ CE C  G++ +P      E               D+
Sbjct:   852 N-EDNYV-----CINCPLGYEGNKCEYCSDGFFEDPLTGKCIECTCNGNIDPMGIGNCDS 905

Query:   218 STGECVQCRGNTEGARCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKEN 277
              TG+C++C G+T G  CE CK  ++G+ +   CKPC C+T G++  +C   +G+C+CKEN
Sbjct:   906 ETGKCLKCIGHTTGDSCESCKEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKEN 965

Query:   278 RAGRTCNLALD--------CPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDT 329
               G  C+   +        CP CDC+  G  S+   C  VSG C C+ GV G +CDQC  
Sbjct:   966 YIGAQCDRCKENHGDVENGCPACDCNDTG--SIGSDCDQVSGQCNCKQGVFGKQCDQCRP 1023

Query:   330 GYWNFTVNGCTSCNCNRDGSLHFS-CDVHTGQCSCKPNMTGLACDQCTEGHWGLQEL-GC 387
              Y+NFT  GC  C+CN  GS+    CD  TG+C C+ N+ G  C++C +G++ +    GC
Sbjct:  1024 SYFNFTDAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITSGDGC 1083

Query:   388 ASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSGMV 447
               C C+  GS + SC+ +TGQCVC+ GVTG  CD C P+++G +  GCTEC  C   G V
Sbjct:  1084 EDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQV 1143

Query:   448 CSEESGQCVCPPLTRGDLCIQCAPNSYGYRPLLGCQPCRCDLRGS 492
             C    G CVCPP T G++C  C  N++ Y PL GC+ C C   GS
Sbjct:  1144 CDPIDGSCVCPPNTVGEMCENCTTNAWDYHPLNGCKLCDCSDIGS 1188
GO:0005604 "basement membrane" evidence=IEA;IDA
GO:0005102 "receptor binding" evidence=IEA
GO:0005606 "laminin-1 complex" evidence=IEA
GO:0030155 "regulation of cell adhesion" evidence=IEA
GO:0030334 "regulation of cell migration" evidence=IEA
GO:0045995 "regulation of embryonic development" evidence=IEA
GO:0007155 "cell adhesion" evidence=IEA
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0040018 "positive regulation of multicellular organism growth" evidence=IMP
GO:0010171 "body morphogenesis" evidence=IMP
GO:0009790 "embryo development" evidence=IMP
ZFIN|ZDB-GENE-060118-1 lama1 "laminin, alpha 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEG3 LAMA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:99892 Lama1 "laminin, alpha 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307207 Lama1 "laminin, alpha 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P25391 LAMA1 "Laminin subunit alpha-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8P9 LAMA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM47 LAMA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMT2 LAMA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEZ5 LAMA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-10
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 5e-10
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 8e-10
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-09
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-09
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 8e-09
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-08
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-08
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 4e-08
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 4e-07
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 2e-06
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-05
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 3e-05
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 8e-05
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-04
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 1e-04
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 4e-04
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 0.002
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information 
 Score = 56.6 bits (137), Expect = 1e-10
 Identities = 23/46 (50%), Positives = 30/46 (65%)

Query: 390 CECNAVGSVNNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGC 435
           C+C+  GS + +CD  TGQC C+  VTGR CD+C P Y+G    GC
Sbjct: 1   CDCDPGGSASGTCDPDTGQCECKPNVTGRRCDRCAPGYYGDGPPGC 46

Length = 46
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 546
KOG0994|consensus 1758 100.0
KOG0994|consensus 1758 100.0
KOG1836|consensus 1705 100.0
KOG1836|consensus 1705 99.97
KOG4289|consensus 2531 99.81
KOG4289|consensus 2531 99.79
KOG1225|consensus525 99.32
KOG1225|consensus525 99.29
KOG1219|consensus 4289 99.23
KOG3512|consensus592 99.22
KOG3512|consensus592 99.18
KOG1219|consensus 4289 99.15
KOG1217|consensus487 99.1
KOG1217|consensus487 98.91
KOG1226|consensus783 98.56
KOG1226|consensus783 98.51
KOG4260|consensus350 98.44
KOG1214|consensus 1289 98.41
KOG4260|consensus350 98.09
KOG1214|consensus 1289 97.99
KOG1218|consensus316 97.95
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 97.69
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 97.68
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 97.65
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 97.62
KOG1218|consensus316 97.6
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.54
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.37
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.47
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.47
smart0005163 DSL delta serrate ligand. 96.27
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.26
smart0005163 DSL delta serrate ligand. 95.91
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.85
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.62
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.58
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.56
smart0017939 EGF_CA Calcium-binding EGF-like domain. 95.31
KOG3509|consensus964 95.3
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.59
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 94.29
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 93.44
PF03302397 VSP: Giardia variant-specific surface protein; Int 92.54
cd0005336 EGF Epidermal growth factor domain, found in epide 92.3
cd0005336 EGF Epidermal growth factor domain, found in epide 92.19
PF03302397 VSP: Giardia variant-specific surface protein; Int 91.87
smart0018135 EGF Epidermal growth factor-like domain. 91.77
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 91.4
KOG3509|consensus964 91.11
smart0018135 EGF Epidermal growth factor-like domain. 90.7
KOG1388|consensus217 89.99
KOG1388|consensus217 88.56
PHA03099139 epidermal growth factor-like protein (EGF-like pro 86.91
PTZ00214800 high cysteine membrane protein Group 4; Provisiona 86.86
smart00281127 LamB Laminin B domain. 86.83
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 85.87
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 84.7
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 83.87
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 83.4
PF00052136 Laminin_B: Laminin B (Domain IV); InterPro: IPR000 81.9
>KOG0994|consensus Back     alignment and domain information 
Probab=100.00  E-value=8e-48  Score=409.20  Aligned_cols=353  Identities=38%  Similarity=0.969  Sum_probs=307.4

Q ss_pred             cCCCCCCCCCCCcccCCCCeeecCCCccCCCCCcCC-----------------------CccccCCcccCCCCCCCCCCC
Q psy14221        130 PCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCE-----------------------PRHILTSRGCASCEDGYIGDH  186 (546)
Q Consensus       130 ~~~C~~~~~~~~~C~~~~g~C~C~~G~~G~~C~~C~-----------------------~~C~~~~~~C~~C~~g~~G~~  186 (546)
                      ++.|++.||.++.|++..|+|.|+|+..|..|++|+                       ..|...++.| +|.+|..|..
T Consensus       764 ~CnCnptGSlS~vCn~~GGqCqCkPnVVGR~CdqCApGtyGFGPsGCk~CdC~~~Gs~~~~Cd~~tGQC-~C~~g~ygrq  842 (1758)
T KOG0994|consen  764 MCNCNPTGSLSSVCNPNGGQCQCKPNVVGRRCDQCAPGTYGFGPSGCKACDCNSIGSLDKYCDKITGQC-QCRPGTYGRQ  842 (1758)
T ss_pred             ccccCCCccccccccCCCceecccCccccccccccCCcccCcCCccCccccccccccccccccccccce-eeccccchhh
Confidence            467899999999999999999999999999999877                       1233367889 9999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCceeCCCC--CCCcCCCCCcccCCCCCcCCCCCCcCCCCcccCC---CCCCCccCCCCCCCCc
Q psy14221        187 CESCDAGYYGNPTELGGSCVPCSCG--GGPCDASTGECVQCRGNTEGARCERCKPLYYGDP---RTGDCKPCECNTSGSL  261 (546)
Q Consensus       187 C~~~~~~c~~~~c~~~g~C~~C~C~--~~~C~~~~g~C~~C~~g~~G~~Ce~C~~G~~g~~---~~~~C~~~~C~~~g~c  261 (546)
                      |.+|.+++++.|     .|.+|+|+  ..+|++.+|.|+.|++.++|.+|++|.+||||++   ....|+|+||..+..-
T Consensus       843 CnqCqpG~WgFP-----eCr~CqCNgHA~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrPCpCP~gp~S  917 (1758)
T KOG0994|consen  843 CNQCQPGYWGFP-----ECRPCQCNGHADTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRPCPCPDGPAS  917 (1758)
T ss_pred             ccccCCCccCCC-----cCccccccCcccccCccccccccccccccccchhhhhccccCCcccCCCCCCCCCCCCCCCcc
Confidence            999999999988     78999999  7899999999999999999999999999999999   4567999999865421


Q ss_pred             ----cccccC----CCceEEcCCCccCCCCC-----------CCCCCCCCCCCCCCCCCCCCCCcCCCcEE-ecCCCCcC
Q psy14221        262 ----GDECDS----ISGQCQCKENRAGRTCN-----------LALDCPPCDCDPLGTLSVPQPCHPVSGTC-YCQPGVTG  321 (546)
Q Consensus       262 ----~~~c~~----~~~~C~C~~g~~G~~C~-----------~~~~C~~~~C~~~g~c~~~~~C~~~~~~C-~C~~g~~G  321 (546)
                          ..+|..    ..-.|.|++||+|.+|+           .+..|+.+.|+++..-.+.+.|+..++.| .|....+|
T Consensus       918 g~~~A~sC~~d~~t~~ivC~C~~GY~G~RCe~CA~~~fGnP~~GGtCq~CeC~~NiD~~d~~aCD~~TG~CLkCL~hTeG  997 (1758)
T KOG0994|consen  918 GRQHADSCYLDTRTQQIVCHCQEGYSGSRCEICADNHFGNPSEGGTCQKCECSNNIDLYDPGACDVATGACLKCLYHTEG  997 (1758)
T ss_pred             chhccccccccccccceeeecccCccccchhhhcccccCCcccCCccccccccCCcCccCCCccchhhchhhhhhhcccc
Confidence                123322    23589999999999998           33458899999999998899999999999 89999999


Q ss_pred             CCCCcCCCCCCccCC-CCCCCCCCCCCCCcc-eecCCCCCeeeeCCCCCCCCCCcCCCCCcCCC-CCCCCCCCCCCCccc
Q psy14221        322 DRCDQCDTGYWNFTV-NGCTSCNCNRDGSLH-FSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQ-ELGCASCECNAVGSV  398 (546)
Q Consensus       322 ~~C~~C~~g~~g~~~-~~C~~~~C~~~g~c~-~~C~~~~~~C~C~~g~~G~~C~~C~~g~~g~~-~~~C~~~~C~~~g~c  398 (546)
                      ++|+.|++||||... ..|..+.|+-.|+-. ..|+..+++|.|.|...|.+|++|.+.+|.+. ..+|.++.|++.+  
T Consensus       998 ~hCe~Ck~Gf~GdA~~q~CqrC~Cn~LGTn~~~~CDr~tGQCpClpNv~G~~CDqCA~N~w~laSG~GCe~C~Cd~~~-- 1075 (1758)
T KOG0994|consen  998 DHCEHCKDGFYGDALRQNCQRCVCNFLGTNSTCHCDRFTGQCPCLPNVQGVRCDQCAENHWNLASGEGCEPCNCDPIG-- 1075 (1758)
T ss_pred             cchhhccccchhHHHHhhhhhheccccccCCccccccccCcCCCCcccccccccccccchhccccCCCCCccCCCccC--
Confidence            999999999999875 568888898777543 35778999999999999999999999999987 7789999998855  


Q ss_pred             CCccccCCceEecCCCCcCCCCCCCCCCCCCCCCCCcccCCcccCCC---CcccCCCCeEeCCCCCccCCCCCCCCCCCC
Q psy14221        399 NNSCDQITGQCVCRKGVTGRTCDKCRPDYFGFSVNGCTECASCEQSG---MVCSEESGQCVCPPLTRGDLCIQCAPNSYG  475 (546)
Q Consensus       399 ~~~c~~~~~~C~C~~G~~G~~C~~C~~~~~g~~~~~C~~c~~C~~~~---g~C~~~~~~C~C~~g~~G~~C~~C~~~~~g  475 (546)
                      ..+|+..+|+|.|++||.|+.|++|..-|||.|...|.+|+ |+..+   -+|+..+++|+|.+|..|.+|++|..||.|
T Consensus      1076 ~pqCN~ftGQCqCkpGfGGR~C~qCqel~WGdP~~~C~aCd-Cd~rG~~tpQCdr~tG~C~C~~Gv~G~rCdqCaRgy~G 1154 (1758)
T KOG0994|consen 1076 GPQCNEFTGQCQCKPGFGGRTCSQCQELYWGDPNEKCRACD-CDPRGIETPQCDRATGRCVCRPGVGGPRCDQCARGYSG 1154 (1758)
T ss_pred             CccccccccceeccCCCCCcchhHHHHhhcCCCCCCceecC-CCCCCCCCCCccccCCceeecCCCCCcchhhhhhhhcC
Confidence            55899999999999999999999999999999988999998 85543   478888999999999999999999999999


Q ss_pred             CCCCCCCCCC-cCCCCCce
Q psy14221        476 YRPLLGCQPC-RCDLRGSM  493 (546)
Q Consensus       476 ~~~~~~C~~c-~c~~~~~~  493 (546)
                      ..  +.|.+| .|+..|..
T Consensus      1155 ~f--P~C~PCh~CF~~WD~ 1171 (1758)
T KOG0994|consen 1155 QF--PVCVPCHECFQTWDA 1171 (1758)
T ss_pred             CC--CCCcchHHHHHHHHH
Confidence            77  567888 78888865

>KOG0994|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PTZ00214 high cysteine membrane protein Group 4; Provisional Back     alignment and domain information
>smart00281 LamB Laminin B domain Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00052 Laminin_B: Laminin B (Domain IV); InterPro: IPR000034 Laminins represent a distinct family of extracellular matrix proteins present only in basement membranes in almost every animal tissue Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 2e-24
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 4e-20
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 7e-15
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 7e-12
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 1e-11
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 9e-05
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 1e-11
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 2e-11
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 1e-04
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 127/272 (46%), Gaps = 39/272 (14%)
Query: 133 CSPYGSVSDECH-EESGQCNCRIGITGRDCSQC-EPRHILTSRGCASCEDGYIGDHCESC 190
           C+P   V++E      G C CR    G +C  C +  H L  R      +G   + C+ C
Sbjct: 263 CAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPA----EGRNSNACKKC 318
Query: 191 DAGYYGNPTELXXXXXXXXXXXXXXDASTGECVQCRGNTEGARCERCKPLYYGDPRT--- 247
           +   + +                  + S G C  C+ NT G  CE+CKP Y+  P     
Sbjct: 319 NCNEHSSSCHFDMAVFLATG-----NVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIR 373
Query: 248 --GDCKPCECNTSGSL-GDECDS--------ISGQCQCKENRAGRTCNLALD-------- 288
               C+PC C+ +GS  G  CD         I+GQC+CK +  G  C++  +        
Sbjct: 374 DPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAE 433
Query: 289 ----CPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFT--VNGCTSC 342
               C  C C+PLGT+    PC   +G CYC+  VTG RCDQC   +W  +  ++GC  C
Sbjct: 434 DPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPC 493
Query: 343 NCNRDGSLHFSCDVHTGQCSCKPNMTGLACDQ 374
           +C+  G+L+ SC   +GQCSC P+M G  C++
Sbjct: 494 DCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE 525
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query546
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-39
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-31
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-25
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 9e-23
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 1e-12
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-26
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-21
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 5e-16
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-15
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 2e-07
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 1e-15
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 4e-11
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 8e-11
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-14
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-12
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-14
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-11
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-09
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 8e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-13
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-06
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-05
2y38_A403 Laminin subunit alpha-5; structural protein, cell 6e-13
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-11
2y38_A403 Laminin subunit alpha-5; structural protein, cell 2e-10
2y38_A403 Laminin subunit alpha-5; structural protein, cell 4e-09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 2e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 5e-12
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 9e-11
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 3e-10
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 5e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 6e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-07
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 7e-06
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-05
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 1e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-04
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-04
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 2e-04
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 2e-04
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
 Score =  150 bits (379), Expect = 2e-39
 Identities = 88/338 (26%), Positives = 121/338 (35%), Gaps = 63/338 (18%)

Query: 115 YGYFGFPSQPNGSCEPCNCSPYGSVSDECHEESGQCNCRIGITGRDCSQCEPRHILTSRG 174
                       S        Y +V D     +  C                       G
Sbjct: 221 VKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGH-ASECAPVDGVNEEVEGMVHG 279

Query: 175 CASCEDGYIGDHCESCDAGYYGNPTELGGS-----CVPCSCGGG-------------PCD 216
              C     G +CE C   Y+  P           C  C+C                  +
Sbjct: 280 HCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGN 339

Query: 217 ASTGECVQCRGNTEGARCERCKPLYYGDPRTG-----DCKPCECNTSGSLGDECDSISGQ 271
            S G C  C+ NT G  CE+CKP Y+  P         C+PC C+ +GS           
Sbjct: 340 VSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGI------ 393

Query: 272 CQCKENRAGRTCNLALDCPPCDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGY 331
                               CD     +         ++G C C+  V G+RCD C  G+
Sbjct: 394 --------------------CDGYTDFS------VGLIAGQCRCKLHVEGERCDVCKEGF 427

Query: 332 WNFT---VNGCTSCNCNRDGSLHF--SCDVHTGQCSCKPNMTGLACDQCTEGHWGLQE-- 384
           ++ +     GC SC CN  G++     CD  TG C CK  +TG  CDQC   HWGL    
Sbjct: 428 YDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDL 487

Query: 385 LGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDK 422
            GC  C+C+  G++NNSC + +GQC C   + GR C++
Sbjct: 488 DGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE 525
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.87
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.82
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.76
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.74
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.72
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.7
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.69
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.64
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.63
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.61
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.61
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.6
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.6
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.55
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.51
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.5
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.48
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.47
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.47
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.45
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.39
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.36
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.01
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.0
2bou_A143 EGF-like module containing mucin-like hormone rece 98.97
2bou_A143 EGF-like module containing mucin-like hormone rece 98.88
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.86
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.71
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 98.7
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.61
2y38_A403 Laminin subunit alpha-5; structural protein, cell 98.6
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 98.59
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.58
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.54
2y38_A403 Laminin subunit alpha-5; structural protein, cell 98.48
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.45
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.4
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.34
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.26
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.16
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.16
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.15
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.14
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.11
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.1
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.96
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.94
1aut_L114 Activated protein C; serine proteinase, plasma cal 97.93
2vh0_B134 Activated factor XA light chain; serine protease, 97.92
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.88
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.88
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.87
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.86
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.84
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 97.83
2vh0_B134 Activated factor XA light chain; serine protease, 97.82
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.75
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.75
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.72
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.71
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 97.7
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 97.65
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.56
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.41
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.29
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.23
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.03
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.01
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.01
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.99
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.98
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.88
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.86
1a3p_A45 Epidermal growth factor; disulfide connectivities, 96.8
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.59
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.55
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.5
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.41
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.22
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.22
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 95.95
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.91
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 95.86
3v65_B 386 Low-density lipoprotein receptor-related protein; 95.48
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.44
3v65_B386 Low-density lipoprotein receptor-related protein; 95.33
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.15
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 94.88
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.4
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 94.27
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 93.63
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.23
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 91.22
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 90.74
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 90.72
2i9a_A145 Urokinase-type plasminogen activator; growth facto 89.63
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 89.56
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 89.51
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.97
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 88.71
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 88.21
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 88.21
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 87.96
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 87.78
2i9a_A145 Urokinase-type plasminogen activator; growth facto 87.49
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 87.25
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 86.92
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 86.92
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 86.89
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 86.37
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 86.07
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 85.82
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 84.4
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 81.05
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
Probab=99.87  E-value=1.2e-22  Score=219.43  Aligned_cols=222  Identities=36%  Similarity=0.883  Sum_probs=119.9

Q ss_pred             CCcccCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCceeCCCC--CCCcC-----------CCCCcccCCCCCcCCC
Q psy14221        171 TSRGCASCEDGYIGDHCESCDAGYYGNPTELG-----GSCVPCSCG--GGPCD-----------ASTGECVQCRGNTEGA  232 (546)
Q Consensus       171 ~~~~C~~C~~g~~G~~C~~~~~~c~~~~c~~~-----g~C~~C~C~--~~~C~-----------~~~g~C~~C~~g~~G~  232 (546)
                      ..+.| .|++||+|.+|+++++++++.|+...     ..+..|.|+  ...|+           ...+.|..|.++|.|.
T Consensus       277 ~~g~C-~C~~G~~G~~Ce~C~~g~~~~p~~~~~c~~~~~~~~C~C~~~~~~C~~d~~~c~~~~~~~gg~C~~C~~g~~G~  355 (525)
T 4aqs_A          277 VHGHC-MCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGR  355 (525)
T ss_dssp             CCCEE-CCCTTEESSSSCEECTTCCSSCCCCCBTTBCCCCCCCCCTTSCSEEEECHHHHHHTTSSCCEEEESCCTTEEST
T ss_pred             cCccc-cCcCCCcCCCCcCCCCccCCCccCCCcccCCCcccccccCCCCCCCCCCcccccccCccCCCcccCCCCCCCCC
Confidence            45677 89999999999998999988887532     223345555  22332           2345666799999999


Q ss_pred             CCCcCCCCcccCCCCCCCccCCCCCCCCccccccCCCceEEcCCCc--cCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCC
Q psy14221        233 RCERCKPLYYGDPRTGDCKPCECNTSGSLGDECDSISGQCQCKENR--AGRTCNLALDCPPCDCDPLGTLSVPQPCHPVS  310 (546)
Q Consensus       233 ~Ce~C~~G~~g~~~~~~C~~~~C~~~g~c~~~c~~~~~~C~C~~g~--~G~~C~~~~~C~~~~C~~~g~c~~~~~C~~~~  310 (546)
                      +|++|.++|++......-.              ......|.|...+  .+..|+....               ..+....
T Consensus       356 ~Ce~C~~g~~~~~~~~~~~--------------~~~~~~C~C~~~~~~~~~~C~~~~~---------------~~~~~~~  406 (525)
T 4aqs_A          356 NCEQCKPFYFQHPERDIRD--------------PNLCEPCTCDPAGSENGGICDGYTD---------------FSVGLIA  406 (525)
T ss_dssp             TSCEECTTEEECSSSCTTC--------------TTCEEECCCCTTTBSGGGCCCCSCB---------------GGGTBCS
T ss_pred             CcccccCcccccCCCCCCC--------------CCCCcCCCCCCCCCCCCccccCCCC---------------CCcCCCC
Confidence            9999999999875221000              0011233443332  3333332110               0122356


Q ss_pred             cEEecCCCCcCCCCCcCCCCCCccCC---CCCCCCCCCCCCCcc--eecCCCCCeeeeCCCCCCCCCCcCCCCCcCCC--
Q psy14221        311 GTCYCQPGVTGDRCDQCDTGYWNFTV---NGCTSCNCNRDGSLH--FSCDVHTGQCSCKPNMTGLACDQCTEGHWGLQ--  383 (546)
Q Consensus       311 ~~C~C~~g~~G~~C~~C~~g~~g~~~---~~C~~~~C~~~g~c~--~~C~~~~~~C~C~~g~~G~~C~~C~~g~~g~~--  383 (546)
                      +.|.|.++|.|.+|++|++||++...   ..|.+++|++.+++.  ..|+..+++|.|++||+|.+|++|++|||+..  
T Consensus       407 ~~C~C~~g~~G~~C~~C~~Gy~G~~c~~~~~C~~C~C~~~gtc~~~~~Cd~~tg~C~C~~g~~G~~Ce~C~~G~~g~~~~  486 (525)
T 4aqs_A          407 GQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSND  486 (525)
T ss_dssp             SCCCBCTTEETTTTCEECTTEECCCTTSTTSSEECCCCTTTBCCSSCCBCTTTCCBCBCTTCCSTTTCC-----------
T ss_pred             CccCCCCCCCCCcccCCCCCCcCCCCCCCCCCccCCCCCCceecCCCcccCCCCEEECCCCCcCCCcccCCCCccCCCCC
Confidence            77899999999999999999998753   468888999888774  46777889999999999999999999999976  


Q ss_pred             CCCCCCCCCCCCcccCCccccCCceEecCCCCcCCCCCC
Q psy14221        384 ELGCASCECNAVGSVNNSCDQITGQCVCRKGVTGRTCDK  422 (546)
Q Consensus       384 ~~~C~~~~C~~~g~c~~~c~~~~~~C~C~~G~~G~~C~~  422 (546)
                      ++.|.+++|++++++...|+..+++|.|++||+|.+|++
T Consensus       487 ~~~C~~C~C~~~gs~~~~C~~~tG~C~C~~G~~G~~Ceq  525 (525)
T 4aqs_A          487 LDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE  525 (525)
T ss_dssp             ---------------------------------------
T ss_pred             CCCCcCCCCCCCCccCCccCCCCCeeECCCCCcCCCCCC
Confidence            677999999999999999998899999999999999974
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 546
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 5e-08
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 5e-07
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 9e-07
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 6e-04
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 0.004
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 8e-07
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 8e-05
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 1e-04
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 1e-04
d1kloa155 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu 1e-04
d1kloa155 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu 0.002
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 47.2 bits (112), Expect = 5e-08
 Identities = 20/44 (45%), Positives = 26/44 (59%)

Query: 292 CDCDPLGTLSVPQPCHPVSGTCYCQPGVTGDRCDQCDTGYWNFT 335
           C C+P GT+     C+PV+G C C P V+G  C  CD GY+N  
Sbjct: 1   CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQ 44
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query546
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.12
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.03
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.03
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.98
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.98
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.97
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.9
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.9
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.88
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.83
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.81
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.79
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.78
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.77
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.75
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.68
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.68
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.6
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.59
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.59
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.5
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.5
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.41
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.34
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.29
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.27
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.26
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.17
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.0
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 96.94
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 96.84
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.82
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 96.63
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.49
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.11
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.01
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 94.63
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.53
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.43
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 93.73
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.54
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 93.48
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 93.25
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 93.22
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 93.22
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.84
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 92.27
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 92.13
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 91.26
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 91.05
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 90.72
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 90.43
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 90.12
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 89.26
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.62
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 88.31
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 88.22
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 87.84
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 87.54
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 82.45
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 81.92
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 80.62
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.12  E-value=7.8e-07  Score=57.50  Aligned_cols=37  Identities=24%  Similarity=0.547  Sum_probs=32.6

Q ss_pred             CCCCCCCCCCCCCCCcceecCCCCCeeeeCCCCCCCCCC
Q psy14221        335 TVNGCTSCNCNRDGSLHFSCDVHTGQCSCKPNMTGLACD  373 (546)
Q Consensus       335 ~~~~C~~~~C~~~g~c~~~C~~~~~~C~C~~g~~G~~C~  373 (546)
                      ++|+|.+.||.++|+|...  ...|+|.|++||+|++||
T Consensus         2 d~d~C~~~PC~ngg~C~~~--~~~y~C~C~~g~~G~~Ce   38 (39)
T d1edmb_           2 DGDQCESNPCLNGGSCKDD--INSYECWCPFGFEGKNCE   38 (39)
T ss_dssp             CCCTTTTCCCCTTCEEEEE--TTEEEEECCTTCCSTTSC
T ss_pred             ccccCCCCCCCCCcEEEcC--CCCEEEECCCCCCCCCCC
Confidence            5688999999999988764  567999999999999997
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure