Diaphorina citri psyllid: psy14224


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
FTNELKVPGLFPPIFNVASKSSIVVNATCGEVGGPEVYCKLKEHRGKADTQCSVCDASSSSPGKKHSIRYVLEQNNMNWWQSPTLHQGPQYEYVTITLDMKQVCPHIDRRPSTIMCRRYALEQNNMNWWQSPTLHQGPQYEYVTITLDMK
cccccccccccccccccccccEEEEEcccccccccCEEEEEcccccccccccccccccccccccccccccccccccccCECcccccccccccEEEEEEEcccCEEECccccccEEEEEEEccccccccccccccccccccEEEEEEEEcc
******VPGLFPPIFNVASKSSIVVNATCGEVGGPEVYCKLKEH****DTQC*VCDASSS*PGKKHSIRYVLEQNNMNWWQSPTLHQGPQYEYVTITLDMKQVCPHIDRRPSTIMCRRYALEQNNMNWWQSPTLHQGPQYEYVTITLDM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FTNELKVPGLFPPIFNVASKSSIVVNATCGEVGGPEVYCKLKEHRGKADTQCSVCDASSSSPGKKHSIRYVLEQNNMNWWQSPTLHQGPQYEYVTITLDMKQVCPHIDRRPSTIMCRRYALEQNNMNWWQSPTLHQGPQYEYVTITLDMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0005488 [MF]bindingprobableGO:0003674
GO:0005605 [CC]basal laminaprobableGO:0005604, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y38, chain A
Confidence level:very confident
Coverage over the Query: 7-29,66-142
View the alignment between query and template
View the model in PyMOL