Diaphorina citri psyllid: psy14230


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MVEEVQKKLENELNLFKQCQKEYQKVLNQRQLLSAQLNENESVQKELDLMKDGEVYKLIGPILVKQEMEEAKQNVKKRIDYISAELKRHDDTIATLDTKQDTHLPITSLA
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
**************LFKQCQKEYQKVLN******AQLNENESVQKELDLMKDGEVYKLIGPILVKQEMEEAKQNVKKRIDYISAELK****************LP*TSL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxxxxxxxxRQLLSAQLNENESVQKELDLMKDGEVYKLIGPILVxxxxxxxxxxxxxxxxxxxxxLKRHDDTIATLDTKQDTHLPITSLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Prefoldin subunit 6 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentQ17Q89
Probable prefoldin subunit 6 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.confidentQ54M71
Probable prefoldin subunit 6 Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity). Required for positioning of the mitotic spindle.confidentP52554

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016272 [CC]prefoldin complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0051131 [BP]chaperone-mediated protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0043622 [BP]cortical microtubule organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0030865, GO:0031122, GO:0008150, GO:0000226, GO:0016043, GO:0044763, GO:0044699
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0015631 [MF]tubulin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZQM, chain A
Confidence level:very confident
Coverage over the Query: 1-108
View the alignment between query and template
View the model in PyMOL