Diaphorina citri psyllid: psy14260


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
MAQMKNKVLVKPVVQNLYDITVFENNLFVTSWRNQSIIRVNKYNSDDYETIANFSRPFAIHIYHRQKQPDDIK
ccccEEEEEEcccccccEEEEEEccEEEEEcccccEEEEEEccccccEEEEEcccccCEEEEECccccccccc
****KNKVLVKPVVQNLYDITVFENNLFVTSWRNQSIIRVNKYNSDDYETIANFSRPFAIHIYHRQK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQMKNKVLVKPVVQNLYDITVFENNLFVTSWRNQSIIRVNKYNSDDYETIANFSRPFAIHIYHRQKQPDDIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030111 [BP]regulation of Wnt receptor signaling pathwayprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S94, chain A
Confidence level:very confident
Coverage over the Query: 1-73
View the alignment between query and template
View the model in PyMOL