Diaphorina citri psyllid: psy14276


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY
cccccccccHHHHHHHHHHHccccccEEEEEEcccCEEEECccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccEEEccccEECccccEEEccccEEEEccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEECcccccccccccccccccEEccccEEEEEEEccccc
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0019369 [BP]arachidonic acid metabolic processprobableGO:0044238, GO:0006631, GO:0008152, GO:0006082, GO:0071704, GO:1901568, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0006690, GO:0008150, GO:0044237, GO:0043436, GO:0001676, GO:0044255, GO:0033559, GO:0044281, GO:0006629
GO:0043651 [BP]linoleic acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0043436, GO:0008150, GO:0019752, GO:0008152, GO:0001676, GO:0044255, GO:0033559, GO:0044281
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0018685 [MF]alkane 1-monooxygenase activityprobableGO:0004497, GO:0016705, GO:0016713, GO:0003824, GO:0003674, GO:0016491
GO:0048252 [BP]lauric acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0019752, GO:0032787, GO:0071704, GO:0008150, GO:0044237, GO:0008152, GO:0043436, GO:0044255, GO:0051791, GO:0044281

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N97, chain A
Confidence level:very confident
Coverage over the Query: 8-251
View the alignment between query and template
View the model in PyMOL