Psyllid ID: psy14276


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY
cccccccccHHHHHHHHHHHccccccEEEEEEcccEEEEEEcHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccEEEccccEEEccccEEEccccEEEEccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEcccccccccccccccccEEccccEEEEEEEccccc
ccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHHccccccEEEEEcccEEcccccEEEccccEEEEEEEEEcccccccccccccccHcccHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcEEccccccccccccccccEEEEccccEEEEEEEccccc
mtfsmgricqthLYRDLYHRFPASVRYFGILigtcptliikdpTLVVKVLIKDFShfydrgfhvgpndylgnnlffmrnpqWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLyhsfpasvRYFGILIdyaipdsrhvipkgvlvhiptyalqtdaalwsdplefnpdrfapeneskivpgsyapfgdgpricigKRFGFLQMKLVLSKVLLnyrvtpcskserrypiktqtllaapegdhwlkftklkpey
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYrvtpcskserrypiktqtllaapegdhwlkftklkpey
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY
****MGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRF******KIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFT******
MTFSMG*ICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLK***
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFSMGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNLFFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYRDLYHSFPASVRYFGILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q64464503 Cytochrome P450 3A13 OS=M yes N/A 0.410 0.208 0.471 5e-21
P05183504 Cytochrome P450 3A2 OS=Ra no N/A 0.355 0.180 0.489 8e-21
Q64459504 Cytochrome P450 3A11 OS=M no N/A 0.355 0.180 0.468 1e-20
P04800504 Cytochrome P450 3A1 OS=Ra no N/A 0.355 0.180 0.479 2e-20
Q9JMA7504 Cytochrome P450 3A41 OS=M no N/A 0.347 0.176 0.489 2e-20
Q64581497 Cytochrome P450 3A18 OS=R no N/A 0.417 0.215 0.453 2e-20
P51538503 Cytochrome P450 3A9 OS=Ra no N/A 0.410 0.208 0.452 7e-20
Q64148503 Lithocholate 6-beta-hydro N/A N/A 0.410 0.208 0.452 8e-20
P24463503 Cytochrome P450 3A12 OS=C yes N/A 0.375 0.190 0.437 8e-20
Q64481504 Cytochrome P450 3A16 OS=M no N/A 0.378 0.192 0.49 2e-19
>sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=2 SV=1 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 143 IPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRF 202
           IPKG +V IPT+AL  D   W +P EF P+RF+ +N+  I P  Y PFG GPR CIG RF
Sbjct: 388 IPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSKKNQDSINPYMYLPFGSGPRNCIGMRF 447

Query: 203 GFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLK 248
             + MK+ L +VL N+ V PC ++E    +  Q LL  PE    LK
Sbjct: 448 ALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLL-QPENPLLLK 492




Can activate aflatoxin B1 to a genotoxic product.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 4EC: .EC: 1
>sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 Back     alignment and function description
>sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 Back     alignment and function description
>sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 Back     alignment and function description
>sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=2 SV=2 Back     alignment and function description
>sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 Back     alignment and function description
>sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 Back     alignment and function description
>sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 Back     alignment and function description
>sp|P24463|CP3AC_CANFA Cytochrome P450 3A12 OS=Canis familiaris GN=CYP3A12 PE=2 SV=1 Back     alignment and function description
>sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
260795905298 hypothetical protein BRAFLDRAFT_117763 [ 0.894 0.768 0.315 5e-28
170063846 499 cytochrome P450 [Culex quinquefasciatus] 0.468 0.240 0.479 3e-25
328720616 518 PREDICTED: probable cytochrome P450 6a14 0.425 0.210 0.470 5e-25
170033941 489 cytochrome P450 6a8 [Culex quinquefascia 0.671 0.351 0.372 1e-24
196051333 510 cytochrome P450 [Anopheles funestus] 0.453 0.227 0.441 6e-24
19702550 509 cytochrome P450 CYP6P3 [Anopheles gambia 0.464 0.233 0.454 7e-24
31206197 509 AGAP002865-PA [Anopheles gambiae str. PE 0.464 0.233 0.454 8e-24
196051319 510 cytochrome P450 [Anopheles funestus] 0.453 0.227 0.441 2e-23
193713791 519 PREDICTED: cytochrome P450 6a2-like [Acy 0.445 0.219 0.452 3e-23
328718669 512 PREDICTED: probable cytochrome P450 6a13 0.429 0.214 0.436 6e-23
>gi|260795905|ref|XP_002592945.1| hypothetical protein BRAFLDRAFT_117763 [Branchiostoma floridae] gi|229278169|gb|EEN48956.1| hypothetical protein BRAFLDRAFT_117763 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 117/238 (49%), Gaps = 9/238 (3%)

Query: 15  RDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGPNDYLGNNL 74
           ++ Y +F    + +GI  G  P LI+ D  LV  + +K+ + F +R    G  D +GN L
Sbjct: 61  KECYKKFN---KVYGIFEGRQPILIVGDLELVKDITVKEANTFTNRRIFEGQGDIIGNGL 117

Query: 75  FFMRNPQWKAARAKMVTVFSTAKMKATFEIVGRICQAHLYR----DLYHSFPASVRYFGI 130
             +++  WK  R+ +   FS+ K+K        + + H       +    FPA+ R+  +
Sbjct: 118 TILKDADWKRVRSAISPTFSSGKLKQGKLDYEAVNEMHFLEMCVNETLRMFPAAQRFDRV 177

Query: 131 LIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPF 190
             +       H IP G +V+IP YA+  D  +W +P +F P+RF+ E +    P +Y PF
Sbjct: 178 CKEDTEVKGLH-IPAGTIVNIPAYAIHHDPEIWPEPEKFKPERFSKEEKESRDPYAYLPF 236

Query: 191 GDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLK 248
           G GPR C+G R   +++K  L+K L   R   C K+     IK  TL    EG  WLK
Sbjct: 237 GSGPRNCVGMRLALMELKFALAKALQKVRFVTCDKTVIPIGIK-NTLGNQIEGGMWLK 293




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|170063846|ref|XP_001867281.1| cytochrome P450 [Culex quinquefasciatus] gi|167881332|gb|EDS44715.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328720616|ref|XP_001945100.2| PREDICTED: probable cytochrome P450 6a14-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170033941|ref|XP_001844834.1| cytochrome P450 6a8 [Culex quinquefasciatus] gi|167875079|gb|EDS38462.1| cytochrome P450 6a8 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|196051333|gb|ACG68822.1| cytochrome P450 [Anopheles funestus] Back     alignment and taxonomy information
>gi|19702550|gb|AAL93295.1|AF487534_1 cytochrome P450 CYP6P3 [Anopheles gambiae] Back     alignment and taxonomy information
>gi|31206197|ref|XP_312050.1| AGAP002865-PA [Anopheles gambiae str. PEST] gi|21295587|gb|EAA07732.1| AGAP002865-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|196051319|gb|ACG68815.1| cytochrome P450 [Anopheles funestus] Back     alignment and taxonomy information
>gi|193713791|ref|XP_001947920.1| PREDICTED: cytochrome P450 6a2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328718669|ref|XP_001946384.2| PREDICTED: probable cytochrome P450 6a13-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
FB|FBgn0033696519 Cyp6g2 "Cyp6g2" [Drosophila me 0.464 0.229 0.371 4.5e-32
FB|FBgn0039006515 Cyp6d4 "Cyp6d4" [Drosophila me 0.367 0.182 0.442 8.1e-31
MGI|MGI:88610503 Cyp3a13 "cytochrome P450, fami 0.410 0.208 0.471 5.4e-30
UNIPROTKB|P24463503 CYP3A12 "Cytochrome P450 3A12" 0.386 0.196 0.44 1.7e-29
FB|FBgn0033304493 Cyp6a13 "Cyp6a13" [Drosophila 0.429 0.223 0.384 1.9e-29
RGD|708379504 Cyp3a2 "cytochrome P450, famil 0.386 0.196 0.49 3.9e-29
UNIPROTKB|P05183504 Cyp3a2 "Cytochrome P450 3A2" [ 0.386 0.196 0.49 3.9e-29
FB|FBgn0025454524 Cyp6g1 "Cyp6g1" [Drosophila me 0.324 0.158 0.457 4.2e-29
UNIPROTKB|Q29496503 CYP3A24 "Cytochrome P450 3A24" 0.410 0.208 0.433 4.7e-29
UNIPROTKB|Q3T047503 CYP3A5 "Uncharacterized protei 0.386 0.196 0.46 4.9e-29
FB|FBgn0033696 Cyp6g2 "Cyp6g2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 4.5e-32, Sum P(2) = 4.5e-32
 Identities = 45/121 (37%), Positives = 71/121 (58%)

Query:   133 DYAI-P-DSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPF 190
             DY++ P   + V+PKG+ V+IP YAL  D   +  P +F P+RF+PEN     P +Y PF
Sbjct:   394 DYSLAPFHKKFVVPKGMPVYIPCYALHMDPQYFPQPRKFLPERFSPENRKLHTPYTYMPF 453

Query:   191 GDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFT 250
             G GP  CIG+RFG+LQ K+ L  +L N+ +T   ++  R  +  + ++   +G   L+  
Sbjct:   454 GLGPHGCIGERFGYLQAKVGLVNLLRNHMITTSERTPHRMQLDPKAIITQAKGGIHLRLV 513

Query:   251 K 251
             +
Sbjct:   514 R 514


GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0017085 "response to insecticide" evidence=IMP
FB|FBgn0039006 Cyp6d4 "Cyp6d4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:88610 Cyp3a13 "cytochrome P450, family 3, subfamily a, polypeptide 13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P24463 CYP3A12 "Cytochrome P450 3A12" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0033304 Cyp6a13 "Cyp6a13" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|708379 Cyp3a2 "cytochrome P450, family 3, subfamily a, polypeptide 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P05183 Cyp3a2 "Cytochrome P450 3A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0025454 Cyp6g1 "Cyp6g1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q29496 CYP3A24 "Cytochrome P450 3A24" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T047 CYP3A5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
pfam00067461 pfam00067, p450, Cytochrome P450 4e-27
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 5e-15
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-13
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 4e-11
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-09
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 4e-09
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-09
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 1e-08
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 4e-08
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 8e-07
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 8e-07
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 3e-06
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-06
pfam00067 461 pfam00067, p450, Cytochrome P450 5e-06
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 5e-06
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 5e-06
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-05
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 1e-05
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 2e-05
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-05
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-05
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 4e-05
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 7e-05
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 2e-04
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-04
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-04
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
 Score =  108 bits (272), Expect = 4e-27
 Identities = 41/114 (35%), Positives = 63/114 (55%), Gaps = 2/114 (1%)

Query: 130 ILIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAP 189
           +  D  IP   ++IPKG LV +  YAL  D  ++ +P EF+P+RF  EN       ++ P
Sbjct: 345 VTKDTVIPG--YLIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLP 402

Query: 190 FGDGPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEG 243
           FG GPR C+G+R   ++MKL L+ +L N+ V     ++     +T  LL  P+ 
Sbjct: 403 FGAGPRNCLGERLARMEMKLFLATLLQNFEVELPPGTDPPDIDETPGLLLPPKP 456


Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461

>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG0158|consensus499 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0157|consensus497 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
KOG0156|consensus489 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
KOG0684|consensus486 99.98
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.96
PLN02648480 allene oxide synthase 99.95
PLN02426 502 cytochrome P450, family 94, subfamily C protein 98.08
>KOG0158|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-51  Score=365.39  Aligned_cols=243  Identities=37%  Similarity=0.710  Sum_probs=214.3

Q ss_pred             ccCHHHHHHHHHHHCCCCCCEEEEEecCeeEEEEcChHHHHHHHHhccccccc--cccccCCCCccc-cccccccCchHH
Q psy14276          7 RICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYD--RGFHVGPNDYLG-NNLFFMRNPQWK   83 (256)
Q Consensus         7 ~~~~~~~~~~~~~~yg~~~~i~~~~~g~~p~vvv~d~e~~~~il~~~~~~F~~--~~~~~~~~~~~~-~~l~~~~~~~w~   83 (256)
                      .++......+.|.+||   |++|+|.|.+|+++|+|||++|+|++++|++|++  ++...+..+.++ .++|.+.|+.|+
T Consensus        51 ~~~~~~~~~~~~~~~~---~~~G~y~~~~p~l~v~D~elik~I~ik~F~~F~~r~~~~~~d~~~~l~~~~Lf~~~g~~WK  127 (499)
T KOG0158|consen   51 RERPGDLLLDIYTKYR---PVVGIYEGRQPALLVSDPELIKEILIKDFDNFYNRKRPIYGDPEDPLSALNLFFLRGERWK  127 (499)
T ss_pred             ccCcHHHHHHHHhcCC---CEEEEEecCCcceEecCHHHHHHHHHHhCccCcCCCCCCcCCCCCcccccCchhccCchHH
Confidence            3334788888888885   9999999999999999999999999999999999  555555443565 899999999999


Q ss_pred             HHHhhhhhhhhchhhhhhHHHHHhhhHh---HH-----------HHH---------------------------------
Q psy14276         84 AARAKMVTVFSTAKMKATFEIVGRICQA---HL-----------YRD---------------------------------  116 (256)
Q Consensus        84 ~lR~e~~~~f~~~~~~~~~~~~~~~~~~---~l-----------i~E---------------------------------  116 (256)
                      ++|..++|+|++++++.|+|++++++.+   +|           +++                                 
T Consensus       128 ~lR~~lsP~Fts~kmk~m~~t~~~~~~~l~~~l~~~~~~~~~~~~~dl~~~yT~DVI~~~AfG~~~~s~~d~~~~F~~~~  207 (499)
T KOG0158|consen  128 RLRTKLSPTFTSGKLKKMFPTMEEVGDELVRHLRRKSEGGQEGEIKDLCARYTTDVIGSCAFGLDANSLRDPKAEFRRMG  207 (499)
T ss_pred             HHHHhhccccchhhHHHHHHHHHHHHHHHHHHHHHhhcccCCccHHHHHHHHHHHHHhHhhcccchhhhcCchHHHHHhh
Confidence            9999999999999999999999999887   33           111                                 


Q ss_pred             --------------------------------------------------------------------------------
Q psy14276        117 --------------------------------------------------------------------------------  116 (256)
Q Consensus       117 --------------------------------------------------------------------------------  116 (256)
                                                                                                      
T Consensus       208 ~~~~~~~~~~~~l~~~~~~~~p~l~~~l~~~~~~~~~~~~~~~~v~~~v~~R~~~~~~r~Dfi~lll~~~~~~~~~~~~~  287 (499)
T KOG0158|consen  208 RRAFFLSRGLFPLKFMLIFLFPKLALPLRVKLFPEDVTDFFRKLVNSRVEQREKENIERNDFIDLLLDARASDFAKSKSH  287 (499)
T ss_pred             HHHHHHhhccchHhHhHHHHhHHHHHhhhcccChHHHHHHHHHHHHHHHHHHHhcCCCCchHHHHHHHhhcccccccccc
Confidence                                                                                            


Q ss_pred             ---------------------------------------------------------------------------HHHhC
Q psy14276        117 ---------------------------------------------------------------------------LYHSF  121 (256)
Q Consensus       117 ---------------------------------------------------------------------------~lRl~  121 (256)
                                                                                                 |||+|
T Consensus       288 ~~lt~dei~aQafvFl~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~ltyd~l~~L~YLd~Vi~ETLR~y  367 (499)
T KOG0158|consen  288 KALTDDEIAAQAFVFLLAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEGLTYDSLSKLKYLDMVIKETLRLY  367 (499)
T ss_pred             cccCHHHHHHHHHHHHHhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCCCCHHHHhCCcHHHHHHHHHHhhC
Confidence                                                                                       99999


Q ss_pred             chhhhhhcc-ceeEEeCCCcEEecCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCChhH
Q psy14276        122 PASVRYFGI-LIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGK  200 (256)
Q Consensus       122 p~~~~~~~~-~~d~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl~~~~~~~~~~~~~~Fg~G~r~C~G~  200 (256)
                      |+++...|. ++|+++++ ++.|+||+.|.++++++||||++||||++|+||||++++.+...+.+|+|||.|||+|+|+
T Consensus       368 P~~~~~~R~C~k~~~i~~-~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGm  446 (499)
T KOG0158|consen  368 PPAPFLNRECTKDYEIPG-GFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGM  446 (499)
T ss_pred             CCcccccceecCceecCC-CeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHH
Confidence            999997765 79999994 4999999999999999999999999999999999998876677889999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhccEEEeCCCCcccccccccceeeecCCCeEEEEEEcC
Q psy14276        201 RFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLK  253 (256)
Q Consensus       201 ~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R~  253 (256)
                      +||++|+|++|++||++|+++.++.+..+...+..++++.|++|++|++++|+
T Consensus       447 Rfa~mq~K~~L~~lL~~f~~~~~~~t~~~~~~~~~~~~l~pk~gi~Lkl~~r~  499 (499)
T KOG0158|consen  447 RFALMEAKLALAHLLRNFSFEVCPTTIIPLEGDPKGFTLSPKGGIWLKLEPRD  499 (499)
T ss_pred             HHHHHHHHHHHHHHHhhCEEecCCcccCcccCCccceeeecCCceEEEEEeCC
Confidence            99999999999999999999999954434333334889999999999999985



>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-20
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-20
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-20
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-10
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 9e-09
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 2e-08
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-08
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-08
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-08
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 3e-08
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 3e-08
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 5e-08
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 5e-08
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 5e-08
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-08
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-08
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 7e-08
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 7e-08
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 7e-08
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 7e-08
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 7e-08
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 7e-08
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 7e-08
1fah_A471 Structure Of Cytochrome P450 Length = 471 7e-08
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 7e-08
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 7e-08
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 8e-08
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 8e-08
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 8e-08
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 8e-08
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 8e-08
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 8e-08
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-08
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 8e-08
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 8e-08
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 8e-08
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 8e-08
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 8e-08
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 9e-08
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-07
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-07
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 1e-07
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-07
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-07
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-07
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 3e-07
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 4e-07
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 4e-07
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 5e-07
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-07
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 7e-07
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-06
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-06
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-06
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 3e-06
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-05
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-05
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 1e-05
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-05
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-05
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-05
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-05
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 3e-05
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-05
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-05
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-05
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 4e-05
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-05
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 4e-05
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-05
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-05
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 6e-05
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-05
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 6e-05
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 2e-04
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 2e-04
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 2e-04
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 3e-04
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-04
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-04
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 5e-04
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 5e-04
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 6e-04
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 6e-04
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 7e-04
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 8e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure

Iteration: 1

Score = 95.5 bits (236), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 42/85 (49%), Positives = 57/85 (67%) Query: 143 IPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKRF 202 IPKGV+V IP+YAL D W++P +F P+RF+ +N+ I P Y PFG GPR CIG RF Sbjct: 366 IPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRF 425 Query: 203 GFLQMKLVLSKVLLNYRVTPCSKSE 227 + MKL L +VL N+ PC +++ Sbjct: 426 ALMNMKLALIRVLQNFSFKPCKETQ 450
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-45
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-23
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 7e-32
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-31
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-30
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-30
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-30
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-29
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 4e-28
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-28
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-26
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 3e-26
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-26
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-26
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-05
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-25
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 7e-25
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-23
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-21
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 9e-20
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-16
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 3e-10
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-10
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-10
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 6e-10
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 8e-10
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-09
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-09
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-09
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 4e-09
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-08
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
 Score =  157 bits (400), Expect = 2e-45
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 3/119 (2%)

Query: 133 DYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGD 192
           D  I      IPKGV+V IP+YAL  D   W++P +F P+RF+ +N+  I P  Y PFG 
Sbjct: 358 DVEING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGS 415

Query: 193 GPRICIGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTK 251
           GPR CIG RF  + MKL L +VL N+   PC +++    +    LL  PE    LK   
Sbjct: 416 GPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLL-QPEKPVVLKVES 473


>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.97
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.97
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.97
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.97
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.97
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.97
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.97
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.97
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.97
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.95
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.94
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.93
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 98.25
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 97.56
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 96.94
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=5.9e-45  Score=327.07  Aligned_cols=246  Identities=16%  Similarity=0.233  Sum_probs=195.1

Q ss_pred             ccccCHHHHHHHHHHHCCCCCCEEEEEecCeeEEEEcChHHHHHHHHhccccccccccccCC----CCccccc-cccccC
Q psy14276          5 MGRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFSHFYDRGFHVGP----NDYLGNN-LFFMRN   79 (256)
Q Consensus         5 ~~~~~~~~~~~~~~~~yg~~~~i~~~~~g~~p~vvv~d~e~~~~il~~~~~~F~~~~~~~~~----~~~~~~~-l~~~~~   79 (256)
                      +..++.+..+.+|.+|||   +||++++|.+++|+|+||+++++||+++...|.+++.....    ....+.+ ++..+|
T Consensus        27 ~~~~~~~~~~~~~~~kYG---~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~~~~~~~~~~~~~~~~~~~~g  103 (479)
T 3tbg_A           27 VDFQNTPYCFDQLRRRFG---DVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYG  103 (479)
T ss_dssp             CCTTSHHHHHHHHHHHHC---SEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCGGGGGGTCBTTBCCSTTCCSS
T ss_pred             hcCCCHHHHHHHHHHHhC---CEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchHHHHHhccCCCCCceeeCCCC
Confidence            346789999999999999   99999999999999999999999999999999887654332    1122333 455569


Q ss_pred             chHHHHHhhhhhhhhchhhhhh--HHHHHhhhHh---HH---------H-------------------------------
Q psy14276         80 PQWKAARAKMVTVFSTAKMKAT--FEIVGRICQA---HL---------Y-------------------------------  114 (256)
Q Consensus        80 ~~w~~lR~e~~~~f~~~~~~~~--~~~~~~~~~~---~l---------i-------------------------------  114 (256)
                      +.|++.|+.+.+.|....+...  .+.+......   .+         +                               
T Consensus       104 ~~w~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~fg~~~~~~~~~~~~~  183 (479)
T 3tbg_A          104 PAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRL  183 (479)
T ss_dssp             HHHHHHHHHHHHHHHHTTSTTCHHHHHHHHHHHHHHHHHHTTTTCCBCTHHHHHHHHHHHHHHHHHSCCCCTTCHHHHHH
T ss_pred             HHHHHHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHHHHHHHhhcCCcccccchhhhhh
Confidence            9999999999888765443211  1111111110   00         0                               


Q ss_pred             --------------------------------------------------------------------------------
Q psy14276        115 --------------------------------------------------------------------------------  114 (256)
Q Consensus       115 --------------------------------------------------------------------------------  114 (256)
                                                                                                      
T Consensus       184 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~  263 (479)
T 3tbg_A          184 LDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGN  263 (479)
T ss_dssp             HHHHHHHHHTTSSHHHHHHHHSGGGGGSHHHHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSCCCSHHHHHHHHHHHTTTC
T ss_pred             hhhhhhhhhhhhhhhhhhhcccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhcccccchhhhhhhhhhhhcccC
Confidence                                                                                            


Q ss_pred             ---------------------------------------------------------------------------HHHHH
Q psy14276        115 ---------------------------------------------------------------------------RDLYH  119 (256)
Q Consensus       115 ---------------------------------------------------------------------------~E~lR  119 (256)
                                                                                                 +|++|
T Consensus       264 ~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlR  343 (479)
T 3tbg_A          264 PESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQR  343 (479)
T ss_dssp             TTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHH
T ss_pred             CccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeecc
Confidence                                                                                       00999


Q ss_pred             hCchhhhhhcc--ceeEEeCCCcEEecCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCC
Q psy14276        120 SFPASVRYFGI--LIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRIC  197 (256)
Q Consensus       120 l~p~~~~~~~~--~~d~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl~~~~~~~~~~~~~~Fg~G~r~C  197 (256)
                      ++|+++...++  .+|++++|  |.||+||.|+++.+++||||++|+||++|+||||++++.....+.+|+|||+|+|.|
T Consensus       344 l~p~~~~~~~~~~~~d~~~~g--~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C  421 (479)
T 3tbg_A          344 FGDIVPLGVTHMTSRDIEVQG--FRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRAC  421 (479)
T ss_dssp             HHCSSTTCCCEECSSCEEETT--EEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSC
T ss_pred             ccccccccceeecCCCceECC--EEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCCCcCC
Confidence            99999887764  57999998  999999999999999999999999999999999998877767788999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHhhccEEEeCCCCcccccccccceeeecCCCeEEEEEEcCCCC
Q psy14276        198 IGKRFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLKPEY  256 (256)
Q Consensus       198 ~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R~~~~  256 (256)
                      +|++||++|+++++|.||++|+|+++++++.+......++++.|+ ++.|+++||+++|
T Consensus       422 ~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~-~~~v~~~pRs~~h  479 (479)
T 3tbg_A          422 LGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPS-PYELCAVPRHHHH  479 (479)
T ss_dssp             TTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEEC-CCCBEEEEC----
T ss_pred             hhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecCC-CeEEEEEECCCCC
Confidence            999999999999999999999999988865544433456677884 7999999999875



>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 256
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 4e-25
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-22
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-22
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 2e-07
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-20
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-08
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 3e-16
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 7e-05
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 5e-16
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-14
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 1e-13
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-13
d1n97a_ 385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-07
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-12
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-11
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 4e-11
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 6e-11
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 8e-11
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 9e-11
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 1e-10
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-10
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 3e-10
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 7e-09
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  100 bits (250), Expect = 4e-25
 Identities = 48/111 (43%), Positives = 64/111 (57%), Gaps = 1/111 (0%)

Query: 141 HVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGK 200
             IPKGV+V IP+YAL  D   W++P +F P+RF+ +N+  I P  Y PFG GPR CIG 
Sbjct: 359 MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGM 418

Query: 201 RFGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTK 251
           RF  + MKL L +VL N+   PC +++    +    LL  PE    LK   
Sbjct: 419 RFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLL-QPEKPVVLKVES 468


>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.98
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.97
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.97
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.97
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.95
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.5e-44  Score=320.85  Aligned_cols=241  Identities=30%  Similarity=0.556  Sum_probs=205.1

Q ss_pred             cccCHHHHHHHHHHHCCCCCCEEEEEecCeeEEEEcChHHHHHHHHhccc-cccccccccCCCCccccccccccCchHHH
Q psy14276          6 GRICQTHLYRDLYHRFPASVRYFGILIGTCPTLIIKDPTLVVKVLIKDFS-HFYDRGFHVGPNDYLGNNLFFMRNPQWKA   84 (256)
Q Consensus         6 ~~~~~~~~~~~~~~~yg~~~~i~~~~~g~~p~vvv~d~e~~~~il~~~~~-~F~~~~~~~~~~~~~~~~l~~~~~~~w~~   84 (256)
                      ..++++..++++.+|||   +||++|+|+.++|||+||+++++||.++.. .|.++..... ....+.+++..+|+.|++
T Consensus        26 ~~~~~~~~~~~~~~kyG---~i~~~~l~~~~~vvv~~p~~~~~il~~~~~~~~~~~~~~~~-~~~~~~~i~~~~g~~~~~  101 (472)
T d1tqna_          26 YHKGFCMFDMECHKKYG---KVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGP-VGFMKSAISIAEDEEWKR  101 (472)
T ss_dssp             GGGCHHHHHHHHHHHHC---SEEEEEETTEEEEEECCHHHHHHHHTTTTTTTCCBCCCCSC-CGGGGGSTTTCCHHHHHH
T ss_pred             hhCCHHHHHHHHHHHhC---CEEEEEECCeeEEEECCHHHHHHHHhcCCcccccCCccccc-ccccCCceeccCcHHHHH
Confidence            46789999999999999   999999999999999999999999987754 4444433322 344567888899999999


Q ss_pred             HHhhhhhhhhchhhhhhHHHHHhhhHhH---H-----------HHH----------------------------------
Q psy14276         85 ARAKMVTVFSTAKMKATFEIVGRICQAH---L-----------YRD----------------------------------  116 (256)
Q Consensus        85 lR~e~~~~f~~~~~~~~~~~~~~~~~~~---l-----------i~E----------------------------------  116 (256)
                      .|+.+.+.|+.+.+..+.+.+.+..+..   +           +.+                                  
T Consensus       102 ~R~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~dl~~~~~~~~~~v~~~~~~G~~~~~~~~~~~~~~~~~~  181 (472)
T d1tqna_         102 LRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTK  181 (472)
T ss_dssp             HHHHTTGGGSHHHHHTTHHHHHHHHHHHHHHHHHHHHHSSCEEHHHHHHHHHHHHHHHTSSCCCCCGGGCTTCHHHHHHT
T ss_pred             hhhhcCccccchhhhcccchhhhhhhcccccccccccccccchhhhhhhccchhhhhheecccccccccccchhhhHHHH
Confidence            9999999998888777767666655441   1           111                                  


Q ss_pred             --------------------------------------------------------------------------------
Q psy14276        117 --------------------------------------------------------------------------------  116 (256)
Q Consensus       117 --------------------------------------------------------------------------------  116 (256)
                                                                                                      
T Consensus       182 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  261 (472)
T d1tqna_         182 KLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHK  261 (472)
T ss_dssp             TCCCCCTTSHHHHHHHHCGGGHHHHHHTTCCSSCHHHHHHHHHHHHHHHTTTTTTCSCCCCCHHHHHHHHHCC----CCC
T ss_pred             HHhhhhhccchhcccccccccccccccccccccchhhhHHHHHHHHHhhhcccccccccccchhhhhhhccccccccccc
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------HHHhCc
Q psy14276        117 --------------------------------------------------------------------------LYHSFP  122 (256)
Q Consensus       117 --------------------------------------------------------------------------~lRl~p  122 (256)
                                                                                                ++|++|
T Consensus       262 ~ls~~ei~~~~l~l~~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p  341 (472)
T d1tqna_         262 ALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFP  341 (472)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCC
T ss_pred             chhhhHHHhhhhhhhhcccccccccceeeccccccCccccccccceeheeccccccchHHHhhccccccceeeeccccCC
Confidence                                                                                      999999


Q ss_pred             hhhhhhcc-ceeEEeCCCcEEecCCcEEEEecccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCChhHH
Q psy14276        123 ASVRYFGI-LIDYAIPDSRHVIPKGVLVHIPTYALQTDAALWSDPLEFNPDRFAPENESKIVPGSYAPFGDGPRICIGKR  201 (256)
Q Consensus       123 ~~~~~~~~-~~d~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl~~~~~~~~~~~~~~Fg~G~r~C~G~~  201 (256)
                      +++...|. .+|+.++|  |.||||+.|+++.+++|+||++|+||++|+||||++.+.....+..++|||+|+|.|+|++
T Consensus       342 ~~~~~~r~~~~d~~~~g--~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~  419 (472)
T d1tqna_         342 IAMRLERVCKKDVEING--MFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMR  419 (472)
T ss_dssp             TTCCEEEECCSCEEETT--EEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHH
T ss_pred             cccccccccccCccccC--ceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccChhHH
Confidence            98876654 78999998  9999999999999999999999999999999999988766667789999999999999999


Q ss_pred             HHHHHHHHHHHHHhhccEEEeCCCCcccccccccceeeecCCCeEEEEEEcC
Q psy14276        202 FGFLQMKLVLSKVLLNYRVTPCSKSERRYPIKTQTLLAAPEGDHWLKFTKLK  253 (256)
Q Consensus       202 ~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R~  253 (256)
                      ||.+++++++|.||++|||+++++.+.+.+.. ...++.|+.++.|+++||+
T Consensus       420 ~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~-~~~~~~p~~~~~~~~~~R~  470 (472)
T d1tqna_         420 FALMNMKLALIRVLQNFSFKPCKETQIPLKLS-LGGLLQPEKPVVLKVESRD  470 (472)
T ss_dssp             HHHHHHHHHHHHHHTTEEEECCTTCCSSCCBC-SSSSCCBSSCCEEEEEETT
T ss_pred             HHHHHHHHHHHHHHHhCEEEeCCCCCCCceec-cceEEeeCCCEEEEEEECC
Confidence            99999999999999999999998876666544 4557789999999999997



>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure