Diaphorina citri psyllid: psy14281


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
VAEKSPEDVRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
cccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHccccCEEEEEEEccEEEEcEEEEEEcccHHHHHHHHcccccccEEEEccccHHHHHHHHccHHccCEEECcccHHHHHHHHHcccccccccccccHHHccc
************LSYY*********************************QYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VAEKSPEDVRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Longitudinals lacking protein-like Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development.very confidentQ7KRI2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031519 [CC]PcG protein complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006342 [BP]chromatin silencingprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0016458, GO:0065007, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0007435 [BP]salivary gland morphogenesisprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0007431, GO:0048856, GO:0044767, GO:0035272, GO:0008150, GO:0048731, GO:0022612, GO:0048732, GO:0009653, GO:0007275, GO:0044699
GO:0001751 [BP]compound eye photoreceptor cell differentiationprobableGO:0032502, GO:0044707, GO:0030154, GO:0009653, GO:0007275, GO:0044699, GO:0001745, GO:0048869, GO:0048513, GO:0048749, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0000978 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001159, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0000987, GO:0003674, GO:0097159, GO:1901363, GO:0005488
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0051704 [BP]multi-organism processprobableGO:0008150
GO:0044708 [BP]single-organism behaviorprobableGO:0050896, GO:0008150, GO:0007610
GO:0007548 [BP]sex differentiationprobableGO:0032502, GO:0003006, GO:0008150, GO:0000003, GO:0022414
GO:0022412 [BP]cellular process involved in reproduction in multicellular organismprobableGO:0032501, GO:0000003, GO:0032504, GO:0009987, GO:0048610, GO:0008150
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003680 [MF]AT DNA bindingprobableGO:0043565, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001078 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcriptionprobableGO:0001227, GO:0003700, GO:0003674, GO:0001071, GO:0000982, GO:0000981
GO:0005700 [CC]polytene chromosomeprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0005694, GO:0043226
GO:0048667 [BP]cell morphogenesis involved in neuron differentiationprobableGO:0032502, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0071840, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0008150
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0000980 [MF]RNA polymerase II distal enhancer sequence-specific DNA bindingprobableGO:0005488, GO:0044212, GO:0043565, GO:0001067, GO:0003677, GO:0001012, GO:0001158, GO:0000976, GO:0000977, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363, GO:0035326
GO:0045165 [BP]cell fate commitmentprobableGO:0032502, GO:0030154, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0007417 [BP]central nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007560 [BP]imaginal disc morphogenesisprobableGO:0032502, GO:0009791, GO:0048707, GO:0009886, GO:0044707, GO:0007444, GO:0048569, GO:0032501, GO:0007552, GO:0048563, GO:0044767, GO:0002165, GO:0048513, GO:0008150, GO:0009887, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0048856
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GA1, chain A
Confidence level:very confident
Coverage over the Query: 49-162
View the alignment between query and template
View the model in PyMOL
Template: 3QLE, chain A
Confidence level:probable
Coverage over the Query: 1-32
View the alignment between query and template
View the model in PyMOL