Psyllid ID: psy14281

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
VAEKSPEDVRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
cccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEEEccEEEEcEEEEEEcccHHHHHHHHcccccccEEEEccccHHHHHHHHccHHccEEEEEcccHHHHHHHHHcccccccccccccHHHHcc
cccccHHHHHHHHHHccccccccccccccccccccccHHHccccccccccEEEEEccccHHHHHHHHHHHcccccEEEEEEEcccEEHHHHHEEHcccHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHccccEccHHHHHHHHHHHHHHHHcccccccHHHHcccc
VAEKSPEDVRQILSYYKQfsdplenfrdsqrklpelpeisktkmngEQQQYYLKWNDFQSNMVTSfkhlrndnsftdvtLACEGQTCKAHKMVLSACSPYFKTLleenpskhpiiilkdvpfkhLTDILEFMYagevnvsqdqlpsFLKTADRLKIKglaeapqssvkreg
vaekspedvRQILSYykqfsdplenFRDSQRKLpelpeisktkmngEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIkglaeapqssvkreg
VAEKSPEDVRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
************LSYY*********************************QYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTA********************
*****************************************************KWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA***********
********VRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLA***********
*****PEDVRQILSYYKQF***************************EQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VAEKSPEDVRQILSYYKQFSDPLENFRDSQRKLPELPEISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKREG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q7KRI2127 Longitudinals lacking pro yes N/A 0.742 1.0 0.820 5e-59
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.730 0.117 0.551 4e-37
Q24174 904 Protein abrupt OS=Drosoph no N/A 0.649 0.122 0.603 9e-37
P42282 813 Protein tramtrack, alpha no N/A 0.660 0.138 0.575 5e-35
P17789 643 Protein tramtrack, beta i no N/A 0.690 0.183 0.559 7e-35
Q24206 880 Broad-complex core protei no N/A 0.672 0.130 0.539 9e-35
Q01295 727 Broad-complex core protei no N/A 0.672 0.158 0.539 1e-34
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.660 0.115 0.566 2e-33
P42283 891 Longitudinals lacking pro no N/A 0.672 0.129 0.530 5e-32
P42284 549 Longitudinals lacking pro no N/A 0.672 0.209 0.530 5e-32
>sp|Q7KRI2|LOLAL_DROME Longitudinals lacking protein-like OS=Drosophila melanogaster GN=lolal PE=1 SV=1 Back     alignment and function desciption
 Score =  226 bits (577), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 116/128 (90%), Gaps = 1/128 (0%)

Query: 44  MNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKT 103
           M    QQ++LKWNDFQ+NMVTSF+HLR++ SFTDVTLACEGQTCKAHKMVLSACSPYFK 
Sbjct: 1   MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKA 60

Query: 104 LLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAP 163
           LLEENPSKHPIIILKDV + HL  ILEFMYAGEVNVSQ+QLP+FLKTADRLK+KGLAE P
Sbjct: 61  LLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETP 120

Query: 164 QSSVKREG 171
            SS+KREG
Sbjct: 121 -SSIKREG 127
Required, together with Trl, for maintaining the repressed state of target genes including homeotic genes Scr and Ubx. May also be involved in the activation of homeotic genes. Binds to a DNA Polycomb response element (PRE) at the bithorax complex. Also binds to polytene chromosomes at several hundred sites, many of which are shared with Trl and ph-p. Required during embryonic development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q24174|ABRU_DROME Protein abrupt OS=Drosophila melanogaster GN=ab PE=1 SV=2 Back     alignment and function description
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|Q24206|BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
242010402127 abrupt protein, putative [Pediculus huma 0.742 1.0 0.875 9e-62
156550568127 PREDICTED: longitudinals lacking protein 0.742 1.0 0.843 6e-60
110756044127 PREDICTED: longitudinals lacking protein 0.742 1.0 0.835 6e-59
240848763125 longitudinals lacking protein-like [Acyr 0.701 0.96 0.866 8e-59
157125571126 abrupt protein [Aedes aegypti] gi|157125 0.730 0.992 0.833 2e-58
31200901126 AGAP011247-PA [Anopheles gambiae str. PE 0.730 0.992 0.833 2e-58
225719214128 Longitudinals lacking protein-like [Cali 0.730 0.976 0.825 3e-58
225710248128 Longitudinals lacking protein-like [Cali 0.730 0.976 0.817 4e-58
225713518128 Longitudinals lacking protein-like [Lepe 0.730 0.976 0.817 7e-58
91085939125 PREDICTED: similar to abrupt protein [Tr 0.725 0.992 0.832 8e-58
>gi|242010402|ref|XP_002425957.1| abrupt protein, putative [Pediculus humanus corporis] gi|212509940|gb|EEB13219.1| abrupt protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 112/128 (87%), Positives = 121/128 (94%), Gaps = 1/128 (0%)

Query: 44  MNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKT 103
           M  EQQQY+LKWNDFQ+NMV+SFKHLR++ SFTDVTLACEGQTCKAHKMVLSACSPYFK+
Sbjct: 1   MASEQQQYFLKWNDFQTNMVSSFKHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKS 60

Query: 104 LLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAP 163
           LLEENPSKHPIIILKDVPF HL  ILEFMYAGEVNVSQDQLP+FLKTADRLK+KGLAEAP
Sbjct: 61  LLEENPSKHPIIILKDVPFSHLQAILEFMYAGEVNVSQDQLPAFLKTADRLKVKGLAEAP 120

Query: 164 QSSVKREG 171
           Q S+KREG
Sbjct: 121 Q-SIKREG 127

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156550568|ref|XP_001603477.1| PREDICTED: longitudinals lacking protein-like isoform 1 [Nasonia vitripennis] gi|345488630|ref|XP_003425953.1| PREDICTED: longitudinals lacking protein-like isoform 2 [Nasonia vitripennis] gi|307166782|gb|EFN60744.1| Longitudinals lacking protein-like [Camponotus floridanus] gi|307207491|gb|EFN85202.1| Longitudinals lacking protein-like [Harpegnathos saltator] gi|332021216|gb|EGI61601.1| Longitudinals lacking protein-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|110756044|ref|XP_001120198.1| PREDICTED: longitudinals lacking protein-like [Apis mellifera] gi|340712770|ref|XP_003394928.1| PREDICTED: longitudinals lacking protein-like [Bombus terrestris] gi|350409197|ref|XP_003488648.1| PREDICTED: longitudinals lacking protein-like [Bombus impatiens] gi|380021548|ref|XP_003694625.1| PREDICTED: longitudinals lacking protein-like [Apis florea] gi|383847541|ref|XP_003699411.1| PREDICTED: longitudinals lacking protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|240848763|ref|NP_001155560.1| longitudinals lacking protein-like [Acyrthosiphon pisum] gi|54287944|gb|AAV31419.1| CG5738-like protein [Toxoptera citricida] gi|239788063|dbj|BAH70727.1| ACYPI004069 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157125571|ref|XP_001654392.1| abrupt protein [Aedes aegypti] gi|157125573|ref|XP_001654393.1| abrupt protein [Aedes aegypti] gi|170037621|ref|XP_001846655.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] gi|94468928|gb|ABF18313.1| BTB/POZ and Kelch domain-containing protein [Aedes aegypti] gi|108873571|gb|EAT37796.1| AAEL010244-PA [Aedes aegypti] gi|108873572|gb|EAT37797.1| AAEL010244-PB [Aedes aegypti] gi|167880866|gb|EDS44249.1| BTB/POZ and Kelch domain-containing protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|31200901|ref|XP_309398.1| AGAP011247-PA [Anopheles gambiae str. PEST] gi|30178468|gb|EAA05153.2| AGAP011247-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|225719214|gb|ACO15453.1| Longitudinals lacking protein-like [Caligus clemensi] Back     alignment and taxonomy information
>gi|225710248|gb|ACO10970.1| Longitudinals lacking protein-like [Caligus rogercresseyi] Back     alignment and taxonomy information
>gi|225713518|gb|ACO12605.1| Longitudinals lacking protein-like [Lepeophtheirus salmonis] gi|290562143|gb|ADD38468.1| Longitudinals lacking protein-like [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|91085939|ref|XP_970530.1| PREDICTED: similar to abrupt protein [Tribolium castaneum] gi|270010169|gb|EFA06617.1| hypothetical protein TcasGA2_TC009535 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.742 1.0 0.820 8.9e-54
FB|FBgn0264442 904 ab "abrupt" [Drosophila melano 0.730 0.138 0.555 3.6e-34
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.888 0.142 0.484 6.1e-33
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.748 0.131 0.515 6e-32
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.690 0.145 0.559 1.4e-31
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.672 0.130 0.539 4.5e-31
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.672 0.144 0.556 1.5e-29
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.672 0.118 0.530 1.2e-28
FB|FBgn0264981 1089 mamo "maternal gene required f 0.713 0.112 0.532 6.7e-28
FB|FBgn0263102 1085 psq "pipsqueak" [Drosophila me 0.684 0.107 0.521 8.5e-28
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 556 (200.8 bits), Expect = 8.9e-54, P = 8.9e-54
 Identities = 105/128 (82%), Positives = 116/128 (90%)

Query:    44 MNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKT 103
             M    QQ++LKWNDFQ+NMVTSF+HLR++ SFTDVTLACEGQTCKAHKMVLSACSPYFK 
Sbjct:     1 MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKA 60

Query:   104 LLEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAP 163
             LLEENPSKHPIIILKDV + HL  ILEFMYAGEVNVSQ+QLP+FLKTADRLK+KGLAE P
Sbjct:    61 LLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAETP 120

Query:   164 QSSVKREG 171
              SS+KREG
Sbjct:   121 -SSIKREG 127
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0006342 "chromatin silencing" evidence=IMP
GO:0016458 "gene silencing" evidence=IMP
GO:0031519 "PcG protein complex" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0007426 "tracheal outgrowth, open tracheal system" evidence=IMP
GO:0007435 "salivary gland morphogenesis" evidence=IMP
FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263102 psq "pipsqueak" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7KRI2LOLAL_DROMENo assigned EC number0.82030.74261.0yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
pfam00651101 pfam00651, BTB, BTB/POZ domain 5e-30
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 7e-27
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 8e-08
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 7e-04
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information 
 Score =  105 bits (263), Expect = 5e-30
 Identities = 35/97 (36%), Positives = 52/97 (53%), Gaps = 2/97 (2%)

Query: 66  FKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKDVPFKHL 125
              LR +    DVTL    +   AHK VL+ACSPYFK L   N      I L+DV  +  
Sbjct: 1   LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFTGNKEVE--ITLEDVSPEDF 58

Query: 126 TDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEA 162
             +LEF+Y G++ ++++ +   L  AD+L+I  L + 
Sbjct: 59  EALLEFIYTGKLEITEENVDDLLALADKLQIPALIDK 95

The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
PHA02713 557 hypothetical protein; Provisional 99.9
KOG4441|consensus 571 99.89
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.87
PHA02790 480 Kelch-like protein; Provisional 99.84
PHA03098 534 kelch-like protein; Provisional 99.81
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.78
KOG4350|consensus 620 99.74
KOG4591|consensus 280 99.62
KOG2075|consensus 521 99.59
KOG4682|consensus 488 99.17
KOG0783|consensus 1267 98.97
KOG0783|consensus 1267 98.93
KOG2838|consensus 401 98.66
KOG2716|consensus 230 98.66
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 98.31
KOG2838|consensus401 98.18
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 97.53
KOG3473|consensus112 97.5
KOG2714|consensus 465 97.31
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 97.19
KOG0511|consensus 516 97.17
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 97.03
KOG0511|consensus 516 96.88
KOG1665|consensus 302 96.64
KOG1724|consensus162 96.19
KOG1987|consensus297 95.88
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 95.85
KOG2715|consensus210 95.36
KOG3840|consensus 438 93.03
KOG2723|consensus 221 89.69
KOG2832|consensus393 87.38
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.90  E-value=1e-23  Score=180.94  Aligned_cols=115  Identities=26%  Similarity=0.373  Sum_probs=105.9

Q ss_pred             eeecccHHHHHHHHHHHhhCCCceeEEEEeC-CEEEEeehhhhcccChhHHhccccC--CC-CCceEEeCCCCHHHHHHH
Q psy14281         53 LKWNDFQSNMVTSFKHLRNDNSFTDVTLACE-GQTCKAHKMVLSACSPYFKTLLEEN--PS-KHPIIILKDVPFKHLTDI  128 (171)
Q Consensus        53 ~~~~~~~~~l~~~l~~~~~~~~~~Dv~i~~~-~~~~~~Hk~iLaa~S~~F~~~f~~~--~~-~~~~i~l~~v~~~~~~~l  128 (171)
                      +..+.|...+++.|+++++++.+|||++.++ |++|+|||.|||++|+||++||.++  +. ...+|.|.++++++|+.+
T Consensus         3 ~~~~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~~e~~~~~~v~l~~v~~~~~~~l   82 (557)
T PHA02713          3 IDDIKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVKNI   82 (557)
T ss_pred             cchhhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCchhhccCceEEeccCCHHHHHHH
Confidence            3456899999999999999999999999997 8999999999999999999999988  44 367899999999999999


Q ss_pred             HHHHhcCccccCCCCHHHHHHHhhhcCccchHhhhhhhhcc
Q psy14281        129 LEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVKR  169 (171)
Q Consensus       129 L~~iYtg~~~~~~~~~~~ll~~A~~~~i~~L~~~c~~~~~r  169 (171)
                      |+|+|||+  ++.+++.+++.+|++|+++.|++.|..++.+
T Consensus        83 l~y~Yt~~--i~~~nv~~ll~aA~~lqi~~l~~~C~~~l~~  121 (557)
T PHA02713         83 VQYLYNRH--ISSMNVIDVLKCADYLLIDDLVTDCESYIKD  121 (557)
T ss_pred             HHHhcCCC--CCHHHHHHHHHHHHHHCHHHHHHHHHHHHHh
Confidence            99999997  5788999999999999999999999997754

>KOG4441|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2715|consensus Back     alignment and domain information
>KOG3840|consensus Back     alignment and domain information
>KOG2723|consensus Back     alignment and domain information
>KOG2832|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2z8h_A138 Structure Of Mouse Bach1 Btb Domain Length = 138 2e-07
2ihc_A124 Crystal Structure Of The Bric-A-Brac (Btb) Domain O 7e-07
2ppi_A144 Structure Of The Btb (Tramtrack And Bric A Brac) Do 3e-06
3m8v_A124 Crystal Structure Of The Btb Domain From KaisoZBTB3 4e-06
1r28_A127 Crystal Structure Of The B-Cell Lymphoma 6 (Bcl6) B 5e-06
2nn2_A133 Crystal Structure Of The Btb Domain From The LrfZBT 5e-06
3m52_A117 Crystal Structure Of The Btb Domain From The Miz-1Z 5e-06
2q81_A119 Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length 6e-06
3ohu_A125 Crystal Structure Of The Human Bach2 Poz Domain, Fo 7e-06
3ga1_A129 Crystal Structure Of The Human Nac1 Poz Domain Leng 1e-05
3hve_A 256 Structures Of Spop-Substrate Complexes: Insights In 1e-05
2if5_A120 Structure Of The Poz Domain Of Human Lrf, A Master 1e-05
3hve_B 256 Structures Of Spop-Substrate Complexes: Insights In 2e-05
3fkc_A116 Crystal Structure Of Human Zinc Finger And Btb Doma 2e-05
3e4u_A130 Crystal Structure Of The Wild-Type Human Bcl6 BtbPO 3e-05
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 9e-05
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 2e-04
4ap2_A 297 Crystal Structure Of The Human Klhl11-cul3 Complex 7e-04
>pdb|2Z8H|A Chain A, Structure Of Mouse Bach1 Btb Domain Length = 138 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 57/104 (54%), Gaps = 1/104 (0%)
Query: 60  SNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKT-LLEENPSKHPIIILK 118
           +N++ S    R  +   DVT+  EGQ  +AH+ VL+ACS YF + ++ +  ++  + + +
Sbjct: 21  TNVLLSLNDQRKKDVLCDVTVLVEGQRFRAHRSVLAACSSYFHSRIVGQTDAELTVTLPE 80
Query: 119 DVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEA 162
           +V  K    +++F Y  ++ +S+D +    +  + L +  + E+
Sbjct: 81  EVTVKGFEPLIQFAYTAKLILSKDNVDEVCRCVEFLSVHNIEES 124
>pdb|2IHC|A Chain A, Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1 Length = 124 Back     alignment and structure
>pdb|2PPI|A Chain A, Structure Of The Btb (Tramtrack And Bric A Brac) Domain Of Human Gigaxonin Length = 144 Back     alignment and structure
>pdb|3M8V|A Chain A, Crystal Structure Of The Btb Domain From KaisoZBTB33, FORM II Length = 124 Back     alignment and structure
>pdb|1R28|A Chain A, Crystal Structure Of The B-Cell Lymphoma 6 (Bcl6) Btb Domain To 2.2 Angstrom Length = 127 Back     alignment and structure
>pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 Back     alignment and structure
>pdb|3M52|A Chain A, Crystal Structure Of The Btb Domain From The Miz-1ZBTB17 Transcription Regulator Length = 117 Back     alignment and structure
>pdb|2Q81|A Chain A, Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length = 119 Back     alignment and structure
>pdb|3OHU|A Chain A, Crystal Structure Of The Human Bach2 Poz Domain, Form I Length = 125 Back     alignment and structure
>pdb|3GA1|A Chain A, Crystal Structure Of The Human Nac1 Poz Domain Length = 129 Back     alignment and structure
>pdb|3HVE|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 Back     alignment and structure
>pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 Back     alignment and structure
>pdb|3HVE|B Chain B, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Gigaxoninbtb3-Box Length = 256 Back     alignment and structure
>pdb|3FKC|A Chain A, Crystal Structure Of Human Zinc Finger And Btb Domain Containing 33 Length = 116 Back     alignment and structure
>pdb|3E4U|A Chain A, Crystal Structure Of The Wild-Type Human Bcl6 BtbPOZ DOMAIN Length = 130 Back     alignment and structure
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|4AP2|A Chain A, Crystal Structure Of The Human Klhl11-cul3 Complex At 2.8a Resolution Length = 297 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-25
2vpk_A116 Myoneurin; transcription regulation, transcription 2e-25
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 2e-25
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 4e-25
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 5e-25
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 5e-25
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 7e-25
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 1e-24
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 1e-24
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-24
3b84_A119 Zinc finger and BTB domain-containing protein 48; 3e-24
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 7e-24
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 3e-23
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 4e-23
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 7e-23
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 8e-22
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-21
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 5e-20
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 6e-20
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 5e-19
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
 Score = 94.7 bits (236), Expect = 1e-25
 Identities = 24/128 (18%), Positives = 57/128 (44%), Gaps = 4/128 (3%)

Query: 39  ISKTKMNGEQQQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACS 98
           +     N   Q   +      + ++ +    R ++ F D  L  +G+     K +L+A S
Sbjct: 11  VDLGTENLYFQSMAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAAS 70

Query: 99  PYFKTL----LEENPSKHPIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRL 154
           PY +T       ++      I L+ +    + +IL+++++G++ +++D +   ++ AD L
Sbjct: 71  PYIRTKLNYNPPKDDGSTYKIELEGISVMVMREILDYIFSGQIRLNEDTIQDVVQAADLL 130

Query: 155 KIKGLAEA 162
            +  L   
Sbjct: 131 LLTDLKTL 138
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.96
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.96
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.96
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.96
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.96
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.96
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.96
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.96
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.96
2vpk_A116 Myoneurin; transcription regulation, transcription 99.95
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.95
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.95
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.94
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.93
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.93
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.93
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.93
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.93
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.92
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.89
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.47
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.39
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.22
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 99.07
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.77
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.77
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.76
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.61
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.33
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 98.09
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 97.61
3kvt_A115 Potassium channel protein SHAW; tetramerization do 97.58
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 97.46
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 97.39
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 97.28
2r9r_B 514 Paddle chimera voltage gated potassium channel KV; 94.28
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 81.21
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
Probab=99.96  E-value=1.2e-29  Score=177.18  Aligned_cols=118  Identities=24%  Similarity=0.421  Sum_probs=111.1

Q ss_pred             ceeEeeecccHHHHHHHHHHHhhCCCceeEEEEeCCEEEEeehhhhcccChhHHhccccCCCCCceEEeCC-CCHHHHHH
Q psy14281         49 QQYYLKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKHPIIILKD-VPFKHLTD  127 (171)
Q Consensus        49 ~~~~~~~~~~~~~l~~~l~~~~~~~~~~Dv~i~~~~~~~~~Hk~iLaa~S~~F~~~f~~~~~~~~~i~l~~-v~~~~~~~  127 (171)
                      ....+.++.|...+++.|+++++++.+|||+|.++|+.|+|||.||+++|+||++||.++......|.+++ +++++|+.
T Consensus         6 ~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~~~~f~aHk~vLaa~S~yF~~~f~~~~~e~~~i~l~~~~~~~~f~~   85 (125)
T 3ohu_A            6 PMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQTKNDLVVSLPEEVTARGFGP   85 (125)
T ss_dssp             CCEEEECSSHHHHHHHHHHHHHHHTCSCCEEEEETTEEEEECHHHHHHHBHHHHHHHTTCCCSSCEEECCTTCCHHHHHH
T ss_pred             cceeeecHHHHHHHHHHHHHHHhcCCccceEEEECCEEEechHHHHHHcCHHHHHHhcCCCCCCcEEEeCCCCCHHHHHH
Confidence            34458889999999999999999999999999999999999999999999999999999855578899998 99999999


Q ss_pred             HHHHHhcCccccCCCCHHHHHHHhhhcCccchHhhhhhh
Q psy14281        128 ILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSS  166 (171)
Q Consensus       128 lL~~iYtg~~~~~~~~~~~ll~~A~~~~i~~L~~~c~~~  166 (171)
                      +|+|+|||++.++.+++.+++.+|++|+++.|++.|+++
T Consensus        86 ~l~~iYtg~~~~~~~~v~~ll~~A~~l~i~~L~~~C~~~  124 (125)
T 3ohu_A           86 LLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDSCFSF  124 (125)
T ss_dssp             HHHHHTTSEEEECTTTHHHHHHHHHHHTBSSCTTSSCCC
T ss_pred             HHHhHcCCceEECHHHHHHHHHHHHHhCCHHHHHHHHHh
Confidence            999999999999999999999999999999999999874
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 5e-25
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 1e-23
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.3 bits (226), Expect = 5e-25
 Identities = 24/112 (21%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 53  LKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEENPSKH 112
           +++    S+++ +   LR+ +  TDV +    +  +AHK VL ACS  F ++  +   ++
Sbjct: 3   IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRN 62

Query: 113 --PIIILKDVPFKHLTDILEFMYAGEVNVSQDQLPSFLKTADRLKIKGLAEA 162
              I +  ++  +    +L+FMY   +N+ +  + + + TA  L+++ + + 
Sbjct: 63  LSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT 114
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.96
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.96
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 98.24
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 98.16
d3kvta_103 akv3.1 voltage-gated potassium channel {California 98.15
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 98.03
d1t1da_100 Shaker potassium channel {California sea hare (Apl 97.64
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 96.77
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 96.66
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 81.66
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=4.6e-30  Score=177.33  Aligned_cols=116  Identities=22%  Similarity=0.421  Sum_probs=107.9

Q ss_pred             eeecccHHHHHHHHHHHhhCCCceeEEEEeCCEEEEeehhhhcccChhHHhccccC--CCCCceEEeCCCCHHHHHHHHH
Q psy14281         53 LKWNDFQSNMVTSFKHLRNDNSFTDVTLACEGQTCKAHKMVLSACSPYFKTLLEEN--PSKHPIIILKDVPFKHLTDILE  130 (171)
Q Consensus        53 ~~~~~~~~~l~~~l~~~~~~~~~~Dv~i~~~~~~~~~Hk~iLaa~S~~F~~~f~~~--~~~~~~i~l~~v~~~~~~~lL~  130 (171)
                      +++++|+.++++.|+++++++.+|||+|.++|++|+|||.||+++|+||++||.+.  ++....+.++++++++|+.+|+
T Consensus         3 ~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e~~~~~~~~~~v~~~~f~~ll~   82 (122)
T d1r29a_           3 IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLD   82 (122)
T ss_dssp             CCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTTTCSEEECCTTSCHHHHHHHHH
T ss_pred             cccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhhhcceeeeecccCHHHHHHHHh
Confidence            67889999999999999999999999999999999999999999999999999887  4444556668899999999999


Q ss_pred             HHhcCccccCCCCHHHHHHHhhhcCccchHhhhhhhhc
Q psy14281        131 FMYAGEVNVSQDQLPSFLKTADRLKIKGLAEAPQSSVK  168 (171)
Q Consensus       131 ~iYtg~~~~~~~~~~~ll~~A~~~~i~~L~~~c~~~~~  168 (171)
                      |+|||++.++.+++.+++.+|++|+|+.|++.|.+++.
T Consensus        83 ~~Ytg~~~i~~~~v~~ll~~A~~l~i~~L~~~C~~~L~  120 (122)
T d1r29a_          83 FMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCRKFIK  120 (122)
T ss_dssp             HHHHSCCCCCTTTHHHHHHHHHHTTCHHHHHHHHHHHH
T ss_pred             hhcCCeecCchhhHHHHHHHHHHHCcHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999654
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure