Diaphorina citri psyllid: psy14285

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MFRRSLGQLKEDIVRANAFVQEANFLAEEMGRQTKFSVTLQIPPANLSPNRRWNCVIQVDICNALFTIPSCTWSELTRKIELWVDILELNDAGDYTPVEVTPSRAPDMLTQIIILNVTLCYVNKTVGGHPRVERCRGLHAGRSHSLPRARHADGVDILELNDAGDYTPVEVTPSRAPDMLTGGTYQLRQGQQRRIQVLVRPVTNSGTLPIICESVGSIAVGSVCLRSRLQKPLDSYQEEDLAVLREKWSDALVRRRQYLDQQIQRLINKQDKSEQDIEREQSLEEQWVNLTEERNAVLVPAPGSGIPGAPADWNPPSDKSEQDIEREQSLVEQWVNLTEERNAVLVPAPGSGIPGAPADWNPPSGMEPHIPVLFLDLNADDLSASNSGPELDYPVAGLHSILPKEHGTKFYNLPLVRHLNQEVGAVATWDSSVHDSQHLNKIT
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccEEEEEEEEECcccccEEEEHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHEEEcEEEEccccccccccccccccccccccccccccccEEEEEEEEEccccccEEEEEEECccccccccccEEEEccccEEEEEEEEEECccccccccccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccEEccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccEEEcccccccccEEEEEEECcccccccccccccc
*********KEDIVRANAFVQEANFLAEEMGRQTKFSVTLQIPPANLSPNRRWNCVIQVDICNALFTIPSCTWSELTRKIELWVDILELNDAGDYTPVEVTPSRAPDMLTQIIILNVTLCYVNKTVGGHPRVERCRGLHA**SHSLPRARHADGVDILELNDAGDYTPVEVTPSRAPDMLTGGTYQLRQGQQRRIQVLVRPVTNSGTLPIICESVGSIAVGSVCLRSRLQKPLDSYQEEDLAVLREKWSDALVRRRQYLDQQIQRL***************SLEEQWVNLTEERNAVLVPAPGSGIPGAPA***************EQSLVEQWVNLTEERNAVLV*************WNPPSGMEPHIPVLFLDLNADDLS*********YPVAGLHSILPKEHGTKFYNLPLVRHLNQEVGAVATWDSSVHDSQHLN***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRRSLGQLKEDIVRANAFVQEANFLAEEMGRQTKFSVTLQIPPANLSPNRRWNCVIQVDICNALFTIPSCTWSELTRKIELWVDILELNDAGDYTPVEVTPSRAPDMLTQIIILNVTLCYVNKTVGGHPRVERCRGLHAGRSHSLPRARHADGVDILELNDAGDYTPVEVTPSRAPDMLTGGTYQLRQGQQRRIQVLVRPVTNSGTLPIICESVGSIAVGSVCLRSRLQKPLDSYQEEDLAVLREKWSDALVRRRQYLDQQxxxxxxxxxxxxxxxxxxxxxEEQWVNLTEERNAVLVPAPGSGIPGAPADWNPPSDKSEQDIEREQSLVEQWVNLTEERNAVLVPAPGSGIPGAPADWNPPSGMEPHIPVLFLDLNADDLSASNSGPELDYPVAGLHSILPKEHGTKFYNLPLVRHLNQEVGAVATWDSSVHDSQHLNKIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-like protein KIF13A Plus end-directed microtubule-dependent motor protein involved in intracellular transport and regulating various processes such as mannose-6-phosphate receptor (M6PR) transport to the plasma membrane, endosomal sorting during melanosome biogenesis and cytokinesis. During melanosome maturation, required for delivering melanogenic enzymes from recycling endosomes to nascent melanosomes by creating peripheral recycling endosomal subdomains in melanocytes. Also required for the abcission step in cytokinesis: mediates translocation of ZFYVE26, and possibly TTC19, to the midbody during cytokinesis (By similarity). Mediates the transport of M6PR-containing vesicles from trans-Golgi network to the plasma membrane via direct interaction with the AP-1 complex.confidentQ9EQW7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003777 [MF]microtubule motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0072383 [BP]plus-end-directed vesicle transport along microtubuleprobableGO:0051234, GO:0007017, GO:0046907, GO:0007018, GO:0047496, GO:0006810, GO:0072384, GO:0072386, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0044699, GO:0051648, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0051640, GO:0051641
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0043001 [BP]Golgi to plasma membrane protein transportprobableGO:0008104, GO:0016482, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0048193, GO:0006810, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0006893, GO:0006892, GO:0016192, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0032588 [CC]trans-Golgi network membraneprobableGO:0005802, GO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!