Diaphorina citri psyllid: psy14303


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MKALVYDEPKGFCSVGSYIRDAACYVCWAFARAYDHHTLEPLVQQIAQGLLVVTCYDKEINCRRAASAAFQELVGRQGGNPPYGIDILTRADYFSVGNRQSAYLDISVYIAQFEAYTRPFIQHLMARKVEHWDPEIRKLTAKTLPRLVPLDREYFLTEVGT
cccEEEEcccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccHHEEEcHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccHHHHHHHccc
*KALVYDEPKGFCSVGSYIRDAACYVCWAFARAYDHHTLEPLVQQIAQGLLVVTCYDKEINCRRAASAAFQELVGRQGGNPPYGIDILTRADYFSVGNRQSAYLDISVYIAQFEAYTRPFIQHLMARKVEHWDPEIRKLTAKTLPRLVPLDREYFLTEVG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKALVYDEPKGFCSVGSYIRDAACYVCWAFARAYDHHTLEPLVQQIAQGLLVVTCYDKEINCRRAASAAFQELVGRQGGNPPYGIDILTRADYFSVGNRQSAYLDISVYIAQFEAYTRPFIQHLMARKVEHWDPEIRKLTAKTLPRLVPLDREYFLTEVGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tubulin-specific chaperone D Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Increases degradation of beta tubulin, when overexpressed in polarized cells. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.confidentQ5ZI87
Tubulin-specific chaperone D Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Acts as a GTPase-activating protein (GAP) for ARL2. Its ability to interact with beta tubulin is regulated via its interaction with ARL2. Induces microtubule disruption in absence of ARL2. Increases degradation of beta tubulin, when overexpressed in polarized cells. Promotes epithelial cell detachment, a process antagonized by ARL2. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.confidentQ28205
Tubulin-specific chaperone D Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Acts as a GTPase-activating protein (GAP) for ARL2. Its ability to interact with beta tubulin is regulated via its interaction with ARL2. Induces microtubule disruption in absence of ARL2. Increases degradation of beta tubulin, when overexpressed in polarized cells. Promotes epithelial cell detachment, a process antagonized by ARL2. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.confidentQ9BTW9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0005096 [MF]GTPase activator activityprobableGO:0030695, GO:0030234, GO:0060589, GO:0008047, GO:0003674
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0010812 [BP]negative regulation of cell-substrate adhesionprobableGO:0010810, GO:0030155, GO:0050794, GO:0008150, GO:0007162, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0048487 [MF]beta-tubulin bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005923 [CC]tight junctionprobableGO:0005575, GO:0070160, GO:0043296, GO:0030054, GO:0005911
GO:0034333 [BP]adherens junction assemblyprobableGO:0022607, GO:0034332, GO:0034330, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0009987, GO:0034329, GO:0044699
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0070830 [BP]tight junction assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0034329, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0043297, GO:0044699
GO:0007023 [BP]post-chaperonin tubulin folding pathwayprobableGO:0044267, GO:0072668, GO:0006457, GO:0044260, GO:0070271, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0044085, GO:0008150, GO:0008152, GO:0044238, GO:0071840
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DB6, chain A
Confidence level:probable
Coverage over the Query: 15-155
View the alignment between query and template
View the model in PyMOL