Diaphorina citri psyllid: psy1431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040---
KPTLHRGSSQHLKVSGRDTYTEEEKAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSPGIRRSFTTVDCLRIEFNPRLTWVLERNEPKNEQVKSRDELLSEKCHFLLSQALDADEAGLKDTAVQLYMQSIEMTKPTLHRGSSQHLKVSGRDTYTEEEKAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSTLHALNGLDTGAARAIRPNDARILTQTSVFENLFTRLHSRAMFWLPWCKREICLRMKKRERSRVDTMQSSVSWSQGLRLLQLKNPWSNVRWRGNYSELDRLHWTPELKRALNFDPNSASMFDNGIFWIDYESILRFYDVFYMNWNPGLFSHTFCVHQELTFEKKNGNSTNCVKTAKQLSIVVFDYVTFKPVIIRNSSLDYFGQWPPSTPAASPKRNFWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEVRIEIWSTYDLMFMFTSENAWRMRPSNDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEISGEWKGLTAGGCPNYPATYPNNPRYQVTLDSRQSMDNTLLVFLKGPKQYSLGVKISCVRLDDETATAPFKTKDSGAYRSGFVAVEMDNLPSGTYEIMPSTFSPQQEGPFFLELKSSCSITISRIR
cccccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHcccccccccccccccccccccccccEEEccccccccccEEEccccccccEEcccccccHHHHHHHHHHccHHHccccEEEEEECccccccccccccccEEEEEEEEccEEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHccccccccccccHHHHHHccccccEEEEcccccccHHHHccccHHHHHHHHHHHcccccccccccccccHcccccccHHccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccccccccEEEccccccccccEEEcccccccccccccccccHHHHHHHHHHcccccccccEEEEEECccccccccccccccEEEEEEEEccEEEEEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccCEEECccccccccHHHHHHHHHHHHHccccEEccccccccccccccccEEEEEEEEEEEECcccEEEEEEcccccccccccccccccccccccHHHHHHcccccccccccccCEEEEHHHHHHHccEEEEEcccccccccCEEEEEEEEECcccccccccccccccEEEEEccccccccCCcccccccccccccccccccccEEEEEEEEcccHHHHHHccccccEEEEEEECccCECcccccccccccccEEEccEEEEEEEccccccccEEEEEEcccccccccEEEEEEEcccCEECccccccccCEEEEEEEccccccEEEEEEcccccccccccccccccccCCcccccEEEEEECccccccEEEEEEcccccccccEEEEEECcccccccccccccEEEEEEEcEECcccccccccccccccccccEEEEEcccccccEEEEEEEcccccEEEEEEEEEECcccccccccccccccccccccEEEEEEEEcccccEEEEccccccccCCcEEEEEEccccccCECcc
************************KAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSPGIRRSFTTVDCLRIEFNPRLTWVLERNEPKNEQVKSRDELLSEKCHFLLSQALDADEAGLKDTAVQLYMQSIEMTKPTLHRGSSQHLKVSGRDTYTEEEKAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSTLHALNGLDTGAARAIRPNDARILTQTSVFENLFTRLHSRAMFWLPWCKREICLRMK***RSRVDTMQSSVSWSQGLRLLQLKNPWSNVRWRGNYSELDRLHWTPELKRALNFDPNSASMFDNGIFWIDYESILRFYDVFYMNWNPGLFSHTFCVHQELTFEKKNGNSTNCVKTAKQLSIVVFDYVTFKPVIIRNSSLDYFGQWPPST**ASPKRNFWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEVRIEIWSTYDLMFMFTSENAWRMRPSNDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEISGEWKGLTAGGCPNYPATYPNNPRYQVTLDSRQSMDNTLLVFLKGPKQYSLGVKISCVRLDDETATAPFKTKDSGAYRSGFVAVEMDNLPSGTYEIMPSTFSPQQEGPFFLELKSSCSITISRI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KPTLHRGSSQHLKVSGRDTYTEEEKAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSPGIRRSFTTVDCLRIEFNPRLTWVLERNEPKNEQVKSRDELLSEKCHFLLSQALDADEAGLKDTAVQLYMQSIEMTKPTLHRGSSQHLKVSGRDTYTEEEKAVLLTTSKINNLNFVPFMNVDLAEKFQYAVPFTDKEGPLILSPKQKRDFVAWVRPSEFCSEPKMVAGEFVDYFSIKQTIVSDCSFVASLAVSALYERRFGKRLVTSIIYPRNRNKEPVYNPFGKYMVKLHLNGITRKVIIDDQLPMARFNQLLCSYSQNKNELWVSILEKAYMKVMGGYDFPGSNSTLHALNGLDTGAARAIRPNDARILTQTSVFENLFTRLHSRAMFWLPWCKREICLRMKKRERSRVDTMQSSVSWSQGLRLLQLKNPWSNVRWRGNYSELDRLHWTPELKRALNFDPNSASMFDNGIFWIDYESILRFYDVFYMNWNPGLFSHTFCVHQELTFEKKNGNSTNCVKTAKQLSIVVFDYVTFKPVIIRNSSLDYFGQWPPSTPAASPKRNFWILLTRHITQLEDFKQNREYITVLVYKNEGKRVYYPYDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEVRIEIWSTYDLMFMFTSENAWRMRPSNDPPPYLDGVRINSPHYLCKIILNENSSRKYTLVVSQYEKMHTIYYTLRAYATCPFRLEKIENPYQFKEEISGEWKGLTAGGCPNYPATYPNNPRYQVTLDSRQSMDNTLLVFLKGPKQYSLGVKISCVRLDDETATAPFKTKDSGAYRSGFVAVEMDNLPSGTYEIMPSTFSPQQEGPFFLELKSSCSITISRIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calpain-7 Calcium-regulated non-lysosomal thiol-protease.confidentQ9R1S8
Calpain-7 Calcium-regulated non-lysosomal thiol-protease.confidentA0FKG7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097264 [BP]self proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152, GO:0006508

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 335-694,707-818
View the alignment between query and template
View the model in PyMOL
Template: 1QXP, chain A
Confidence level:very confident
Coverage over the Query: 40-229
View the alignment between query and template
View the model in PyMOL
Template: 2QFE, chain A
Confidence level:very confident
Coverage over the Query: 903-1043
View the alignment between query and template
View the model in PyMOL
Template: 1DF0, chain A
Confidence level:probable
Coverage over the Query: 362-532,548-586,622-635
View the alignment between query and template
View the model in PyMOL
Template: 2W2U, chain A
Confidence level:probable
Coverage over the Query: 248-292
View the alignment between query and template
View the model in PyMOL