Diaphorina citri psyllid: psy14322

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------

MDEQAISRARDELRFRGVKGTTGTQASFLELFNDITLQFATSPFSPRSRVKQHGKENDLVDRIRADPYFAPILNQMPTLLDPKSFYGRAPEQVVDVD

ccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHccccccccHHHHHHHcccccccccccccccccc

MDEQAISRARDELRFRGVKGTTGTQASFLELFNDITLQFATSPFSPR**VKQHGKENDLVDRIRADPYFAPILNQMPTLLDPKSFYGRAPEQV****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDEQAISRARDELRFRGVKGTTGTQASFLELFNDITLQFATSPFSPRSRVKQHGKENDLVDRIRADPYFAPILNQMPTLLDPKSFYGRAPEQVVDVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Adenylosuccinate lyase		confident	A3KN12
Adenylosuccinate lyase		confident	O60105
Adenylosuccinate lyase		confident	P21265

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044208 [BP]	'de novo' AMP biosynthetic process	probable	GO:0055086, GO:0044237, GO:0009167, GO:0034641, GO:0009165, GO:0006807, GO:0009163, GO:0009161, GO:0072521, GO:0072522, GO:0009126, GO:0009259, GO:0009168, GO:0006139, GO:0044710, GO:0042451, GO:1901362, GO:1901360, GO:0042278, GO:0009127, GO:0008150, GO:0071704, GO:0009124, GO:0044281, GO:0018130, GO:0009119, GO:0009987, GO:1901576, GO:0009156, GO:0006793, GO:0006725, GO:0009152, GO:0046033, GO:0009150, GO:0009260, GO:0009058, GO:0009117, GO:0009116, GO:0008152, GO:0034654, GO:1901564, GO:0046129, GO:0046128, GO:0090407, GO:0042455, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:0044249, GO:1901137, GO:1901135, GO:0046390, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:0009123, GO:0006167, GO:1901293, GO:0006164, GO:0019637, GO:0019438, GO:0006753, GO:1901659
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0070626 [MF]	(S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succ inate AMP-lyase (fumarate-forming) activity	probable	GO:0003824, GO:0016829, GO:0003674, GO:0016840, GO:0016842
GO:0007584 [BP]	response to nutrient	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0006106 [BP]	fumarate metabolic process	probable	GO:0043648, GO:0044710, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051262 [BP]	protein tetramerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J91, chain A
Confidence level:very confident
Coverage over the Query: 44-96
View the alignment between query and template
View the model in PyMOL

Template: 2J91, chain A
Confidence level:very confident
Coverage over the Query: 2-36
View the alignment between query and template
View the model in PyMOL