>gi|401885911|gb|EJT49990.1| adenylosuccinate lyase [Trichosporon asahii var. asahii CBS 2479] gi|406697414|gb|EKD00674.1| adenylosuccinate lyase [Trichosporon asahii var. asahii CBS 8904]
This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting. Length = 436
Score = 65.0 bits (159), Expect = 7e-14
Identities = 22/42 (52%), Positives = 31/42 (73%)
Query: 47 RSRVKQHGKENDLVDRIRADPYFAPILNQMPTLLDPKSFYGR 88
+ VKQ G +NDL++RI+ D YF PI +++ LLDPK+F GR
Sbjct: 395 AAVVKQEGGDNDLIERIKNDAYFKPIWDELDALLDPKTFIGR 436
This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting. Length = 436
Score = 35.9 bits (84), Expect = 3e-04
Identities = 12/38 (31%), Positives = 19/38 (50%), Gaps = 2/38 (5%)
Query: 58 DLVDRIRADPYFAPILN--QMPTLLDPKSFYGRAPEQV 93
DL + + ADP L+ ++ L DP+ + G A V
Sbjct: 40 DLRELLLADPEVTAYLSEEELEELFDPEYYLGHADAIV 77
Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP). This entry represents the C-terminal, seven alpha-helical, domain of adenylosuccinate lyase. Length = 81
This group contains ASL, prokaryotic-type 3-carboxy-cis,cis-muconate cycloisomerase (pCMLE), and related proteins. These proteins are members of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and; the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). pCMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone, in the beta-ketoadipate pathway. ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting. Length = 381
Score = 34.7 bits (81), Expect = 7e-04
Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
Query: 56 ENDLVDRIRADPYFAPILN--QMPTLLDPKSFYGRAPEQV 93
DL + + ADP A L+ ++ L DP + G A V
Sbjct: 37 GRDLREVLLADPEVAAYLSEEELDALFDPAYYLGHADAIV 76
This is the C-terminal seven alpha helices of the structure whose full length represents the enzyme adenylosuccinate lyase. This sequence lies C-terminal to the conserved motif necessary for beta-elimination reactions, Adenylosuccinate lyase catalyzes two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide, the eighth step of the de novo pathway, and the formation of adenosine monophosphate (AMP) from adenylosuccinate, the second step in the conversion of inosine monophosphate into AMP. Length = 80
Score = 35.4 bits (82), Expect = 0.002
Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 8/60 (13%)
Query: 45 SPRSRVKQHGK------ENDLVDRIRADPYFAPILNQ--MPTLLDPKSFYGRAPEQVVDV 96
V++ E DL++ + AD L + + LLDP+++ G A E V V
Sbjct: 376 EAYEIVRELAMGAAEVDEPDLLEFLLADERITKYLKEEELAELLDPETYIGNAREIVERV 435
This family consists of adenylosuccinate lyase, the enzyme that catalyzes step 8 in the purine biosynthesis pathway for de novo synthesis of IMP and also the final reaction in the two-step sequence from IMP to AMP [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]. Length = 435
>PF10397 ADSL_C: Adenylosuccinate lyase C-terminus; InterPro: IPR019468 Adenylosuccinate lyase catalyses two steps in the synthesis of purine nucleotides: the conversion of succinylaminoimidazole-carboxamide ribotide into aminoimidazole-carboxamide ribotide (the fifth step of de novo IMP biosynthesis); the formation of adenosine monophosphate (AMP) from adenylosuccinate (the final step in the synthesis of AMP from IMP) []
This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting.
This family consists of adenylosuccinate lyase, the enzyme that catalyzes step 8 in the purine biosynthesis pathway for de novo synthesis of IMP and also the final reaction in the two-step sequence from IMP to AMP.
This subgroup contains pCLME and related proteins, and belongs to the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. CMLE catalyzes the cyclization of 3-carboxy-cis,cis-muconate (3CM) to 4-carboxy-muconolactone in the beta-ketoadipate pathway. This pathway is responsible for the catabolism of a variety of aromatic compounds into intermediates of the citric cycle in prokaryotic and eukaryotic micro-organisms.
This group contains ASAL and related proteins. It is a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASAL is a cytosolic enzyme which catalyzes the reversible breakdown of argininosuccinate to arginine and fumarate during arginine biosynthesis. In ureotelic species ASAL also catalyzes a reaction involved in the production of urea. Included in this group are the major soluble avian eye lens proteins from duck, delta 1 and delta 2 crystallin. Of these two isoforms only delta 2 has retained ASAL activity. These crystallins may have evolved by, gene recruitment of ASAL followed by gene duplication.
>COG0015 PurB Adenylosuccinate lyase [Nucleotide transport and metabolism]
Structural Genomics Of Caenorhabditis Elegans: Aden
4e-05
>pdb|4FLC|A Chain A, Structural And Biochemical Characterization Of Human Adenylosuccinate Lyase (Adsl) And The R303c Adsl Deficiency Associated Mutation Length = 487
>pdb|2VD6|A Chain A, Human Adenylosuccinate Lyase In Complex With Its Substrate N6-(1,2-Dicarboxyethyl)-Amp, And Its Products Amp And Fumarate. Length = 503
>pdb|4FFX|A Chain A, Structural And Biochemical Characterization Of Human Adenylosuccinate Lyase (Adsl) And The R303c Adsl Deficiency Associated Mutation Length = 487
>3c8t_A Fumarate lyase; structural genomics, PSI-2, protein structure initiat YORK SGX research center for structural genomics, nysgxrc; 2.20A {Mesorhizobium SP}
>3bhg_A Adenylosuccinate lyase; structural G PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.90A {Legionella pneumophila subsp}
>4hgv_A Fumarase C, fumarate hydratase class II; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 2.09A {Sinorhizobium meliloti}
Score = 33.5 bits (75), Expect = 0.002
Identities = 12/50 (24%), Positives = 18/50 (36%), Gaps = 3/50 (6%)
Query: 50 VKQHGKEN-DLVDRIRADPYFAPILN--QMPTLLDPKSFYGRAPEQVVDV 96
K E L D I N Q+ + P+S+ G +Q+ V
Sbjct: 391 CKTAVAEQKHLKDIISQVDEVKQYFNPSQLDEIFKPESYLGNIQDQIDAV 440
