Diaphorina citri psyllid: psy14327


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
ILNIIILILYRTGYGGQFLGVGGTWNLNEEKNPDVEIIASGVFVGYFVYTTVILISYGFGTTQQNETLVDIIMNFIAIFLWIAVGGIALHYWIGYQNEHHYQQVTSERGIGITLGILCIFSGALYLIDTVLSFIHFIKDL
ccEEEEEEEEEEccccCEEECccCEccccccccccEEEEEEEEEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ILNIIILILYRTGYGGQFLGVGGTWNLNEEKNPDVEIIASGVFVGYFVYTTVILISYGFGTTQQNETLVDIIMNFIAIFLWIAVGGIALHYWIGYQNEHHYQQVTSERGIGITLGILCIFSGALYLIDTVLSFIHFIKDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ILNIIILILYRTGYGGQFLGVGGTWNLNEEKNPDVEIIASGVFVGYFVYTTVILISYGFGTTQQNETLVDIIMNFIAIFLWIAVGGIALHYWIGYQNEHHYQQVTSERGIGITLGILCIFSGALYLIDTVLSFIHFIKDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005920 [CC]smooth septate junctionconfidentGO:0070160, GO:0005575, GO:0005911, GO:0043296, GO:0030054, GO:0005918
GO:0005887 [CC]integral to plasma membraneconfidentGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0060576 [BP]intestinal epithelial cell developmentprobableGO:0060575, GO:0048565, GO:0030154, GO:0048468, GO:0055123, GO:0032501, GO:0007275, GO:0044699, GO:0048869, GO:0030855, GO:0002066, GO:0002064, GO:0002065, GO:0032502, GO:0009987, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048731, GO:0044707, GO:0048856, GO:0044763
GO:0007496 [BP]anterior midgut developmentprobableGO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0007494, GO:0007275, GO:0044699
GO:0019991 [BP]septate junction assemblyprobableGO:0022607, GO:0034330, GO:0016043, GO:0034329, GO:0008150, GO:0044085, GO:0007043, GO:0071840, GO:0045216, GO:0044763, GO:0009987, GO:0043297, GO:0044699
GO:0061028 [BP]establishment of endothelial barrierprobableGO:0032502, GO:0044699, GO:0030154, GO:0003158, GO:0060429, GO:0048468, GO:0009888, GO:0044767, GO:0044763, GO:0048869, GO:0030855, GO:0001885, GO:0008150, GO:0009987, GO:0045446, GO:0002064, GO:0048856

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted