Diaphorina citri psyllid: psy14331

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----

MRGIWDRHAMSWTIMFNEDIEKIVRDIEAEEKRKNKVIEKVVPEPTRRANFSFLAHPDKDQLILFGGEFYDGQKFVFGSPKALDHLILMNLFVSAPGAPPPRCSHQMVALSADKGQLWMFGGEFSSASESQFHHYKDLWVFRMGEKKWEKIVCKDTPPSRSGHRMIALKKHLVVFGGFHDNLREAKYYNDVHIFDLETYAWKKIEPLGAGPAPRSGCQMAATPDGKILISGGYSKQSVKKDVDKGIVHTDTFLLTPDSKTLRSCL

ccccccccccEEEEEcHHHHHHHHHHHHHcEEEEEEEEccccccccccccccEEEEccccEEEEEcccccccccEEEccEEEEEccccEEEEccccccccccccccEEEEcccccEEEEEccccccccccccEECcEEEEEEcccccEEEECccccccccccCEEEEEccEEEEEccccccccccEEEcCEEEEEccccEEEEECccccccccccccEEEEEcccEEEEEccccccccccccccEEECccEEEECcccccccccc

***IWDRHAMSWTIMFNEDIEKIVRDIEAEEKRKNKVIEKVVPEPTRRANFSFLAHPDKDQLILFGGEFYDGQKFVFGSPKALDHLILMNLFVSAPGAPPPRCSHQMVALSADKGQLWMFGGEFSSASESQFHHYKDLWVFRMGEKKWEKIVCKDTPPSRSGHRMIALKKHLVVFGGFHDNLREAKYYNDVHIFDLETYAWKKIEPLGAGPAPRSGCQMAATPDGKILISGGYSKQSVKKDVDKGIVHTDTFLLTPDSKTLRSCL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRGIWDRHAMSWTIMFNEDxxxxxxxxxxxxxxxxxxxxxVVPEPTRRANFSFLAHPDKDQLILFGGEFYDGQKFVFGSPKALDHLILMNLFVSAPGAPPPRCSHQMVALSADKGQLWMFGGEFSSASESQFHHYKDLWVFRMGEKKWEKIVCKDTPPSRSGHRMIALKKHLVVFGGFHDNLREAKYYNDVHIFDLETYAWKKIEPLGAGPAPRSGCQMAATPDGKILISGGYSKQSVKKDVDKGIVHTDTFLLTPDSKTLRSCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Kelch domain-containing protein 4		confident	Q921I2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003674 [MF]	molecular_function	probable
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019762 [BP]	glucosinolate catabolic process	probable	GO:1901575, GO:0019748, GO:0019759, GO:0044273, GO:0071704, GO:1901136, GO:0016145, GO:0019757, GO:0044710, GO:0044237, GO:0016143, GO:0044248, GO:1901657, GO:0006790, GO:0008152, GO:0019760, GO:0008150, GO:0009987, GO:0009056, GO:1901135, GO:1901658

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3II7, chain A
Confidence level:very confident
Coverage over the Query: 21-263
View the alignment between query and template
View the model in PyMOL