Diaphorina citri psyllid: psy14347

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MNLTACVEGYKHDQPCSTRPINNYNYPFISKCEQKCAAYNEKEQIRVVYIVKSALRHFERRLAIRQSWGYEKRFSDVPIVTVFILGYDPDNEGLQIEIAEESERYNDIVQAKFIDSYFNNTIKTMMGFKWAANYCKHSKFYFFADDDFYVSTRNVLRFLRNPLQYPQYLELPIETIQSKSNIMDYELPSDVKLFSGFVFVSSPHRHYTSKWYISLQEYPYHLWPPYVTAGSYVVSREVLLDFYFASHFTKHFRFDDIYLGILAKKTNTEPFHCGEFYFYKKDYSLHNYQYVIASHGYGNHDELLRVWNEQRGIGNA
ccHHHHHcccccccccccccccccccccccccHHHHccccccccEEEEEEEEcccccHHHHHHHHHHHccccccccccEEEEEEEECccccHHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEccccEEEEHHHHHHHHHcccccccccccccHHHHcccccccccccccccEEEEEEccccccccccccccccccccccccccccccccCEEEcHHHHHHHHHHHcccccccccHHHHHHHHHHccccCEECcccCCcccccccccccEEEEEEccccHHHHHHHHHHHHHcccc
*NLTACVEGY*****CSTRPINNYNYPFISKCEQKCAAYNEKEQIRVVYIVKSALRHFERRLAIRQSWGYEKRFSDVPIVTVFILGYDPDNEGLQIEIAEESERYNDIVQAKFIDSYFNNTIKTMMGFKWAANYCKHSKFYFFADDDFYVSTRNVLRFLRNPLQYPQYLELPIETIQSKSNIMDYELPSDVKLFSGFVFVSSPHRHYTSKWYISLQEYPYHLWPPYVTAGSYVVSREVLLDFYFASHFTKHFRFDDIYLGILAKKTNTEPFHCGEFYFYKKDYSLHNYQYVIASHGYGNHDELLRVWN*QRG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLTACVEGYKHDQPCSTRPINNYNYPFISKCEQKCAAYNEKEQIRVVYIVKSALRHFERRLAIRQSWGYEKRFSDVPIVTVFILGYDPDNEGLQIEIAEESERYNDIVQAKFIDSYFNNTIKTMMGFKWAANYCKHSKFYFFADDDFYVSTRNVLRFLRNPLQYPQYLELPIETIQSKSNIMDYELPSDVKLFSGFVFVSSPHRHYTSKWYISLQEYPYHLWPPYVTAGSYVVSREVLLDFYFASHFTKHFRFDDIYLGILAKKTNTEPFHCGEFYFYKKDYSLHNYQYVIASHGYGNHDELLRVWNEQRGIGNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-1,3-galactosyltransferase 1 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.confidentQ7JK26
Beta-1,3-galactosyltransferase 1 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues.confidentQ9Y5Z6
Beta-1,3-galactosyltransferase 1 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins.confidentO54904

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008378 [MF]galactosyltransferase activityprobableGO:0016758, GO:0016740, GO:0003674, GO:0016757, GO:0003824
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0008194 [MF]UDP-glycosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.62Ganglioside galactosyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:confident
Coverage over the Query: 45-162,188-200,223-295
View the alignment between query and template
View the model in PyMOL
Template: 1XHB, chain A
Confidence level:probable
Coverage over the Query: 44-164,189-273
View the alignment between query and template
View the model in PyMOL