Diaphorina citri psyllid: psy1435


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH
ccccccccccccccccccccCEECccccccccccccccccccccEEEEEEcccccEEEEEEcccccHHHHHHHccccccccccccccccccEEECccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEcccccccEEEccccccHHHHcccccccc
**LRNLLCKLPPVV**************************EDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYV********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adrenodoxin-like protein, mitochondrial very confidentP37193
Adrenodoxin-like protein, mitochondrial confidentQ9CPW2
Adrenodoxin-like protein, mitochondrial confidentQ05B51

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0022900 [BP]electron transport chainprobableGO:0044710, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0051537 [MF]2 iron, 2 sulfur cluster bindingprobableGO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009055 [MF]electron carrier activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y5C, chain A
Confidence level:very confident
Coverage over the Query: 42-125,137-159
View the alignment between query and template
View the model in PyMOL