Psyllid ID: psy1435

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH
ccccccccccccccccccccEEEEccccccccccccccccccccEEEEEEcccccEEEEEEccccHHHHHHHHccccccccccccccccccEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccEEEEcccccccEEEcccccHHHHHcccccccc
ccHHHHHccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccHHHHHHHccccEcccccccccccccEEEccHHHHcccccccHHHHHHHcccccccccEEEHHHccccccccccEEEEccccccEEEEcccccccEEEcccccccc
mflrnllcklppvvrpnnvhrihtsvctrhgeyewqdpksedeivnitfidkdgkrreikgkvgdnVLYLAHRyeipmegaceaslacttchvyvkheyldalppaeekeddlldlapflkdnsrlgcqnvmynsrlGCQIILTKELegievtlpkatrnfyvdghtpkph
mflrnllcklppvvrpnnvhriHTSVCtrhgeyewqdpksedeivnitfidkdgkrreikgkvgdnVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEgievtlpkatrnfyvdghtpkph
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH
**LRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPP*****DDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYV********
**********************************************ITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYV********
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH
MFLRNLLCKLPPVV**************************EDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGH*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLRNLLCKLPPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
P37193172 Adrenodoxin-like protein, yes N/A 0.865 0.860 0.670 2e-59
Q9CPW2174 Adrenodoxin-like protein, yes N/A 0.771 0.758 0.594 7e-46
Q6P4F2183 Adrenodoxin-like protein, yes N/A 0.760 0.710 0.581 1e-44
Q05B51186 Adrenodoxin-like protein, yes N/A 0.847 0.779 0.532 3e-44
Q08C57195 Adrenodoxin-like protein, yes N/A 0.847 0.743 0.535 3e-43
Q5FWQ0193 Adrenodoxin-like protein, N/A N/A 0.742 0.658 0.586 6e-42
Q9AKM6112 2Fe-2S ferredoxin OS=Rick yes N/A 0.619 0.946 0.461 2e-23
Q9AKH1112 2Fe-2S ferredoxin OS=Rick yes N/A 0.619 0.946 0.461 3e-23
Q4UKL2112 2Fe-2S ferredoxin OS=Rick yes N/A 0.619 0.946 0.452 5e-23
Q9ZDW6112 2Fe-2S ferredoxin OS=Rick yes N/A 0.619 0.946 0.461 6e-23
>sp|P37193|ADXH_DROME Adrenodoxin-like protein, mitochondrial OS=Drosophila melanogaster GN=Fdxh PE=2 SV=3 Back     alignment and function desciption
 Score =  228 bits (580), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 13/161 (8%)

Query: 11  PPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYL 70
           P    P+N   +HT++  RHGE+EWQDPKS DEIVNIT++DKDGKR +++GKVGDNVLYL
Sbjct: 25  PAFYTPHNA--LHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYL 82

Query: 71  AHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQN 130
           AHR+ I MEGACEASLACTTCHVYV+H+YL  L  AEE+EDDLLD+APFL++        
Sbjct: 83  AHRHGIEMEGACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRE-------- 134

Query: 131 VMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH 171
              NSRLGCQI+L K +EG+E+ LPKATRNFYVDGH PKPH
Sbjct: 135 ---NSRLGCQILLDKSMEGMELELPKATRNFYVDGHKPKPH 172

Drosophila melanogaster (taxid: 7227)
>sp|Q9CPW2|ADXL_MOUSE Adrenodoxin-like protein, mitochondrial OS=Mus musculus GN=Fdx1l PE=2 SV=1 Back     alignment and function description
>sp|Q6P4F2|ADXL_HUMAN Adrenodoxin-like protein, mitochondrial OS=Homo sapiens GN=FDX1L PE=1 SV=1 Back     alignment and function description
>sp|Q05B51|ADXL_BOVIN Adrenodoxin-like protein, mitochondrial OS=Bos taurus GN=FDX1L PE=2 SV=1 Back     alignment and function description
>sp|Q08C57|ADXL_DANRE Adrenodoxin-like protein, mitochondrial OS=Danio rerio GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|Q5FWQ0|ADXL_XENLA Adrenodoxin-like protein, mitochondrial OS=Xenopus laevis GN=fdx1l PE=2 SV=1 Back     alignment and function description
>sp|Q9AKM6|FER2_RICMO 2Fe-2S ferredoxin OS=Rickettsia montana GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9AKH1|FER2_RICRI 2Fe-2S ferredoxin OS=Rickettsia rickettsii GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q4UKL2|FER2_RICFE 2Fe-2S ferredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fdxB PE=3 SV=1 Back     alignment and function description
>sp|Q9ZDW6|FER2_RICPR 2Fe-2S ferredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=fdxB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
195326271172 GM24883 [Drosophila sechellia] gi|195588 0.865 0.860 0.677 4e-58
350413787170 PREDICTED: adrenodoxin-like protein, mit 0.812 0.817 0.753 5e-58
170036909165 adrenodoxin [Culex quinquefasciatus] gi| 0.894 0.927 0.664 9e-58
383286760178 FI20231p1 [Drosophila melanogaster] 0.865 0.831 0.670 9e-58
156549524171 PREDICTED: adrenodoxin-like protein, mit 0.935 0.935 0.655 9e-58
24661503172 ferredoxin, isoform A [Drosophila melano 0.865 0.860 0.670 9e-58
357620021166 hypothetical protein KGM_17533 [Danaus p 0.771 0.795 0.734 2e-57
340710056170 PREDICTED: adrenodoxin-like protein, mit 0.812 0.817 0.746 3e-57
21064791172 RH67819p [Drosophila melanogaster] 0.865 0.860 0.664 3e-57
195490890172 GE21252 [Drosophila yakuba] gi|194179431 0.865 0.860 0.670 4e-57
>gi|195326271|ref|XP_002029853.1| GM24883 [Drosophila sechellia] gi|195588997|ref|XP_002084243.1| GD12935 [Drosophila simulans] gi|194118796|gb|EDW40839.1| GM24883 [Drosophila sechellia] gi|194196252|gb|EDX09828.1| GD12935 [Drosophila simulans] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 130/161 (80%), Gaps = 13/161 (8%)

Query: 11  PPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYL 70
           P    P+N   +HT++  RHGE+EWQDPKS+DEIVNIT++DKDGKR +I+GKVGDNVLYL
Sbjct: 25  PAFYTPHNA--LHTTIPRRHGEFEWQDPKSKDEIVNITYVDKDGKRTKIQGKVGDNVLYL 82

Query: 71  AHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQN 130
           AHR+ I MEGACEASLACTTCHVYV+H+YL  L  AEE+EDDLLD+APFL++        
Sbjct: 83  AHRHGIEMEGACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRE-------- 134

Query: 131 VMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH 171
              NSRLGCQI+L K +EG+E+ LPKATRNFYVDGH PKPH
Sbjct: 135 ---NSRLGCQILLDKSMEGMELELPKATRNFYVDGHKPKPH 172

Source: Drosophila sechellia

Species: Drosophila sechellia

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350413787|ref|XP_003490112.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170036909|ref|XP_001846303.1| adrenodoxin [Culex quinquefasciatus] gi|167879931|gb|EDS43314.1| adrenodoxin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383286760|gb|AFH01423.1| FI20231p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|156549524|ref|XP_001600711.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|24661503|ref|NP_523993.1| ferredoxin, isoform A [Drosophila melanogaster] gi|320545722|ref|NP_001189075.1| ferredoxin, isoform B [Drosophila melanogaster] gi|33860138|sp|P37193.3|ADXH_DROME RecName: Full=Adrenodoxin-like protein, mitochondrial; Flags: Precursor gi|23093810|gb|AAF50293.2| ferredoxin, isoform A [Drosophila melanogaster] gi|318069172|gb|ADV37512.1| ferredoxin, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|357620021|gb|EHJ72359.1| hypothetical protein KGM_17533 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340710056|ref|XP_003393614.1| PREDICTED: adrenodoxin-like protein, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|21064791|gb|AAM29625.1| RH67819p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195490890|ref|XP_002093330.1| GE21252 [Drosophila yakuba] gi|194179431|gb|EDW93042.1| GE21252 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0011769172 Fdxh "Ferredoxin" [Drosophila 0.865 0.860 0.670 4.2e-56
WB|WBGene00013532169 Y73F8A.27 [Caenorhabditis eleg 0.830 0.840 0.623 1.2e-47
MGI|MGI:1915415174 Fdx1l "ferredoxin 1-like" [Mus 0.771 0.758 0.594 5.7e-43
RGD|1561264174 Fdx1l "ferredoxin 1-like" [Rat 0.771 0.758 0.587 3.2e-42
UNIPROTKB|Q6P4F2183 FDX1L "Adrenodoxin-like protei 0.760 0.710 0.581 6.6e-42
UNIPROTKB|F1S3K4186 LOC100526209 "Uncharacterized 0.760 0.698 0.588 6.6e-42
UNIPROTKB|K7GN28183 LOC100526209 "Uncharacterized 0.760 0.710 0.588 6.6e-42
UNIPROTKB|Q05B51186 FDX1L "Adrenodoxin-like protei 0.760 0.698 0.581 8.4e-42
UNIPROTKB|E2RM76186 FDX1L "Uncharacterized protein 0.847 0.779 0.538 2.8e-41
ZFIN|ZDB-GENE-060929-1046195 fdx1l "ferredoxin 1-like" [Dan 0.818 0.717 0.551 3.6e-41
FB|FBgn0011769 Fdxh "Ferredoxin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 4.2e-56, P = 4.2e-56
 Identities = 108/161 (67%), Positives = 129/161 (80%)

Query:    11 PPVVRPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYL 70
             P    P+N   +HT++  RHGE+EWQDPKS DEIVNIT++DKDGKR +++GKVGDNVLYL
Sbjct:    25 PAFYTPHNA--LHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYL 82

Query:    71 AHRYEIPMEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQN 130
             AHR+ I MEGACEASLACTTCHVYV+H+YL  L  AEE+EDDLLD+APFL++NSRLGCQ 
Sbjct:    83 AHRHGIEMEGACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQ- 141

Query:   131 VMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH 171
                       I+L K +EG+E+ LPKATRNFYVDGH PKPH
Sbjct:   142 ----------ILLDKSMEGMELELPKATRNFYVDGHKPKPH 172
GO:0009055 "electron carrier activity" evidence=ISS;NAS
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
WB|WBGene00013532 Y73F8A.27 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1915415 Fdx1l "ferredoxin 1-like" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1561264 Fdx1l "ferredoxin 1-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P4F2 FDX1L "Adrenodoxin-like protein, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3K4 LOC100526209 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GN28 LOC100526209 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q05B51 FDX1L "Adrenodoxin-like protein, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM76 FDX1L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1046 fdx1l "ferredoxin 1-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P4F2ADXL_HUMANNo assigned EC number0.58150.76020.7103yesN/A
P37193ADXH_DROMENo assigned EC number0.67080.86540.8604yesN/A
P37098FER2_CAUCRNo assigned EC number0.34780.60230.9716yesN/A
Q12184ADRX_YEASTNo assigned EC number0.42330.71920.7151yesN/A
Q1RJ69FER2_RICBRNo assigned EC number0.45290.61980.9549yesN/A
Q9ZDW6FER2_RICPRNo assigned EC number0.46150.61980.9464yesN/A
Q9AKH1FER2_RICRINo assigned EC number0.46150.61980.9464yesN/A
Q05B51ADXL_BOVINNo assigned EC number0.53200.84790.7795yesN/A
Q92J08FER2_RICCNNo assigned EC number0.44440.61980.9464yesN/A
Q9CPW2ADXL_MOUSENo assigned EC number0.59440.77190.7586yesN/A
Q4UKL2FER2_RICFENo assigned EC number0.45290.61980.9464yesN/A
Q08C57ADXL_DANRENo assigned EC number0.53500.84790.7435yesN/A
Q9AKM6FER2_RICMONo assigned EC number0.46150.61980.9464yesN/A
Q9AKC4FER2_RICTYNo assigned EC number0.44620.64320.9401yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
PLN02593117 PLN02593, PLN02593, adrenodoxin-like ferredoxin pr 2e-52
TIGR02007110 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC s 1e-19
COG0633102 COG0633, Fdx, Ferredoxin [Energy production and co 2e-15
PTZ00490143 PTZ00490, PTZ00490, Ferredoxin superfamily; Provis 4e-15
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding 1e-05
pfam0011177 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster bindin 0.002
>gnl|CDD|178203 PLN02593, PLN02593, adrenodoxin-like ferredoxin protein Back     alignment and domain information 
 Score =  162 bits (413), Expect = 2e-52
 Identities = 63/128 (49%), Positives = 84/128 (65%), Gaps = 12/128 (9%)

Query: 45  VNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHE-YLDAL 103
           +++TF+DKDG+ R +K  VG ++L  AH  +I +EGACE SLAC+TCHV V  E   + L
Sbjct: 1   ISVTFVDKDGEERTVKAPVGMSLLEAAHENDIELEGACEGSLACSTCHVIVMDEKVYNKL 60

Query: 104 PPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYV 163
           P   ++E+D+LDLA  L +            SRLGCQ+I   EL+G+ + LP ATRNF V
Sbjct: 61  PEPTDEENDMLDLAFGLTE-----------TSRLGCQVIAKPELDGMRLALPAATRNFAV 109

Query: 164 DGHTPKPH 171
           DGH PKPH
Sbjct: 110 DGHVPKPH 117

Length = 117
>gnl|CDD|131062 TIGR02007, fdx_isc, ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>gnl|CDD|223706 COG0633, Fdx, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|185668 PTZ00490, PTZ00490, Ferredoxin superfamily; Provisional Back     alignment and domain information
>gnl|CDD|238126 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|215725 pfam00111, Fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG3309|consensus159 100.0
PLN02593117 adrenodoxin-like ferredoxin protein 99.98
PTZ00490143 Ferredoxin superfamily; Provisional 99.95
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 99.86
COG0633102 Fdx Ferredoxin [Energy production and conversion] 99.85
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 99.77
CHL0013499 petF ferredoxin; Validated 99.73
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.7
PTZ00038191 ferredoxin; Provisional 99.69
PLN03136148 Ferredoxin; Provisional 99.66
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 99.62
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 99.61
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 99.61
COG3894 614 Uncharacterized metal-binding protein [General fun 99.57
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.56
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 99.55
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.53
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 99.53
PRK05713 312 hypothetical protein; Provisional 99.48
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.41
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 99.38
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.94
PRK07569 234 bidirectional hydrogenase complex protein HoxU; Va 98.81
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.54
PTZ00305 297 NADH:ubiquinone oxidoreductase; Provisional 98.09
PRK07860 797 NADH dehydrogenase subunit G; Validated 97.92
PRK12814 652 putative NADPH-dependent glutamate synthase small 97.92
PRK08493 819 NADH dehydrogenase subunit G; Validated 97.87
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 97.83
PRK09129 776 NADH dehydrogenase subunit G; Validated 97.83
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 97.68
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 97.68
PRK09130 687 NADH dehydrogenase subunit G; Validated 97.67
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.59
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 97.54
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 97.5
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 97.45
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 97.38
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 97.23
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 97.21
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 97.08
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 97.05
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 96.96
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 96.92
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 96.75
PRK12386 251 fumarate reductase iron-sulfur subunit; Provisiona 96.61
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 96.6
PRK12576 279 succinate dehydrogenase iron-sulfur subunit; Provi 96.49
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 96.3
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 96.19
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 96.16
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 96.16
PRK09800 956 putative hypoxanthine oxidase; Provisional 95.44
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 95.25
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 95.09
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 94.28
KOG2282|consensus 708 94.0
PLN00192 1344 aldehyde oxidase 92.36
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 92.29
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 91.14
>KOG3309|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-33  Score=221.50  Aligned_cols=143  Identities=52%  Similarity=0.853  Sum_probs=128.8

Q ss_pred             ecCcceeEEeeeeeccccccccCCCCCCCceEEEEEcCCCCEEEEEecCCchHHHHHHHCCCCCcCCCCCCccccccEEE
Q psy1435          15 RPNNVHRIHTSVCTRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVY   94 (171)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~~~~~~p~~~~~mv~Vtfv~~~G~~~~v~~~~G~tLLdaa~~~gI~i~~~CgG~G~CgtC~V~   94 (171)
                      .+..-|+++|++-.--+ ++|..+++.+  |+|+|+++||+.+.+.+..|+|||++|.+|||++++.|+|.-+|.||||+
T Consensus        17 ~~~~~~~f~~~~t~~~~-~~~~~~~~e~--i~Itfv~~dG~~~~i~g~vGdtlLd~ah~n~idleGACEgslACSTCHVi   93 (159)
T KOG3309|consen   17 PFTRNHIFRTSSTSEFS-PSKGPRKVED--IKITFVDPDGEEIKIKGKVGDTLLDAAHENNLDLEGACEGSLACSTCHVI   93 (159)
T ss_pred             ccccceeeccCcccccc-cccCCCCCce--EEEEEECCCCCEEEeeeecchHHHHHHHHcCCCccccccccccccceEEE
Confidence            34455666676655444 5666444444  99999999999999999999999999999999999999999999999999


Q ss_pred             EecCCccCCCCCChHHHhhcccCCCCCCCeeeccccccCCCceeeeEEEecCCCceEEEeCCCcccccccCCCCCCC
Q psy1435          95 VKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATRNFYVDGHTPKPH  171 (171)
Q Consensus        95 V~~g~~~~L~~~t~~E~~~L~~~~~~~~g~R~~~~~~~~~~RLACQ~~v~~dl~glvV~vp~~~~~~~~~~~~~~~~  171 (171)
                      |.+.+++++++++++|.++|+.+..+.+.||           |+||+.++++||||+|+||...+|+++||+.||||
T Consensus        94 v~~~~yekl~ep~DeE~DmLDlA~gLt~tSR-----------LGCQI~l~keldG~~v~vP~atrn~~vd~~~~kph  159 (159)
T KOG3309|consen   94 VDEEYYEKLPEPEDEENDMLDLAFGLTETSR-----------LGCQIVLTKELDGMRVAVPEATRNFRVDGFVPKPH  159 (159)
T ss_pred             EcHHHHhcCCCCcchHHHHHHhhhccccccc-----------cceEEEeccccCCcEEECccccccccccCCCCCCC
Confidence            9999999999999999999999888999999           99999999999999999999999999999999998

>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>KOG2282|consensus Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2y5c_A109 Structure Of Human Ferredoxin 2 (Fdx2)in Complex Wi 3e-36
2wlb_A103 Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schi 2e-20
1l6v_A128 Structure Of Reduced Bovine Adrenodoxin Length = 12 5e-17
1cje_A127 Adrenodoxin From Bovine Length = 127 7e-17
1l6u_A128 Nmr Structure Of Oxidized Adrenodoxin Length = 128 7e-17
1e6e_B128 Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHO 7e-17
3p1m_A132 Crystal Structure Of Human Ferredoxin-1 (Fdx1) In C 3e-16
3n9z_C123 Crystal Structure Of Human Cyp11a1 In Complex With 5e-16
3n9y_C114 Crystal Structure Of Human Cyp11a1 In Complex With 5e-16
2bt6_A108 Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 6e-16
1ayf_A105 Bovine Adrenodoxin (oxidized) Length = 105 1e-15
2jqr_B105 Solution Model Of Crosslinked Complex Of Cytochrome 6e-15
3hui_A126 Crystal Structure Of The Mutant A105r Of [2fe-2s] F 1e-12
1oqq_A106 Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOX 3e-12
1gpx_A106 C85s Gapdx, Nmr, 20 Structures Length = 106 3e-12
1pdx_A106 Putidaredoxin Length = 106 6e-12
1oqr_A106 Crystal Structure Of C73s Mutant Of Putidaredoxin, 7e-12
1r7s_A106 Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Lengt 7e-12
1put_A106 An Nmr-Derived Model For The Solution Structure Of 1e-11
1e9m_A106 Ferredoxin Vi From Rhodobacter Capsulatus Length = 1e-11
1i7h_A111 Crystal Sturcuture Of Fdx Length = 111 3e-11
3na0_C68 Crystal Structure Of Human Cyp11a1 In Complex With 2e-08
3ah7_A113 Crystal Structure Of The Isc-Like [2fe-2s] Ferredox 3e-08
3lxf_A104 Crystal Structure Of [2fe-2s] Ferredoxin Arx From N 3e-07
1b9r_A105 Terpredoxin From Pseudomonas Sp Length = 105 9e-05
>pdb|2Y5C|A Chain A, Structure Of Human Ferredoxin 2 (Fdx2)in Complex With 2fe2s Cluster Length = 109 Back     alignment and structure 
Iteration: 1

 Score =  147 bits (370), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 11/117 (9%)
Query: 43  EIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEGACEASLACTTCHVYVKHEYLDA 102
           ++VN+ F+D+ G+R  + G+VGDNVL+LA R+ + +EGACEASLAC+TCHVYV  ++LD 
Sbjct: 4   DVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDL 63
Query: 103 LPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATR 159
           LPP EE+EDD+LD+AP L++N           SRLGCQI+LT ELEG E TLPK TR
Sbjct: 64  LPPPEEREDDMLDMAPLLQEN-----------SRLGCQIVLTPELEGAEFTLPKITR 109
>pdb|2WLB|A Chain A, Adrenodoxin-Like Ferredoxin Etp1fd(516-618) Of Schizosaccharomyces Pombe Mitochondria Length = 103 Back     alignment and structure
>pdb|1L6V|A Chain A, Structure Of Reduced Bovine Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1CJE|A Chain A, Adrenodoxin From Bovine Length = 127 Back     alignment and structure
>pdb|1L6U|A Chain A, Nmr Structure Of Oxidized Adrenodoxin Length = 128 Back     alignment and structure
>pdb|1E6E|B Chain B, Adrenodoxin ReductaseADRENODOXIN COMPLEX OF MITOCHONDRIAL P450 Systems Length = 128 Back     alignment and structure
>pdb|3P1M|A Chain A, Crystal Structure Of Human Ferredoxin-1 (Fdx1) In Complex With Iron- Sulfur Cluster Length = 132 Back     alignment and structure
>pdb|3N9Z|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 22- Hydroxycholesterol Length = 123 Back     alignment and structure
>pdb|3N9Y|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 114 Back     alignment and structure
>pdb|2BT6|A Chain A, Ru(Bpy)2(Mbpy)-Modified Bovine Adrenodoxin Length = 108 Back     alignment and structure
>pdb|1AYF|A Chain A, Bovine Adrenodoxin (oxidized) Length = 105 Back     alignment and structure
>pdb|2JQR|B Chain B, Solution Model Of Crosslinked Complex Of Cytochrome C And Adrenodoxin Length = 105 Back     alignment and structure
>pdb|3HUI|A Chain A, Crystal Structure Of The Mutant A105r Of [2fe-2s] Ferredoxin In The Class I Cyp199a2 System From Rhodopseudomonas Palustris Length = 126 Back     alignment and structure
>pdb|1OQQ|A Chain A, Crystal Structure Of C73sC85S MUTANT OF PUTIDAREDOXIN, A [2FE-2s] Ferredoxin From Pseudomonas Putida, At 1.47a Resolution Length = 106 Back     alignment and structure
>pdb|1GPX|A Chain A, C85s Gapdx, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1PDX|A Chain A, Putidaredoxin Length = 106 Back     alignment and structure
>pdb|1OQR|A Chain A, Crystal Structure Of C73s Mutant Of Putidaredoxin, A [2fe- 2s] Ferredoxin From Pseudomonas Putida, At 1.65a Resolution Length = 106 Back     alignment and structure
>pdb|1R7S|A Chain A, Putidaredoxin (Fe2s2 Ferredoxin), C73g Mutant Length = 106 Back     alignment and structure
>pdb|1PUT|A Chain A, An Nmr-Derived Model For The Solution Structure Of Oxidized Putidaredoxin, A 2fe, 2-S Ferredoxin From Pseudomonas Length = 106 Back     alignment and structure
>pdb|1E9M|A Chain A, Ferredoxin Vi From Rhodobacter Capsulatus Length = 106 Back     alignment and structure
>pdb|1I7H|A Chain A, Crystal Sturcuture Of Fdx Length = 111 Back     alignment and structure
>pdb|3NA0|C Chain C, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 68 Back     alignment and structure
>pdb|3AH7|A Chain A, Crystal Structure Of The Isc-Like [2fe-2s] Ferredoxin (Fdxb) From Pseudomonas Putida Jcm 20004 Length = 113 Back     alignment and structure
>pdb|3LXF|A Chain A, Crystal Structure Of [2fe-2s] Ferredoxin Arx From Novosphingobium Aromaticivorans Length = 104 Back     alignment and structure
>pdb|1B9R|A Chain A, Terpredoxin From Pseudomonas Sp Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 2e-53
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 3e-53
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 4e-52
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 9e-50
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 3e-49
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 9e-48
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 3e-47
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 3e-46
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 7e-46
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 7e-46
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 2e-44
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 2e-32
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Length = 126 Back     alignment and structure
 Score =  164 bits (418), Expect = 2e-53
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 13/133 (9%)

Query: 28  TRHGEYEWQDPKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIP-MEGACEASL 86
             H       P+       I F+D  G+ R ++ + G  V+  A R  IP +E  C  + 
Sbjct: 6   HHHHHSSGLVPRGSHMA-KINFVDHTGETRTVEVEEGATVMEAAIRNAIPGVEAECGGAC 64

Query: 87  ACTTCHVYVKHEYLDALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKE 146
           AC TCHVYV   + + +      E+D+LD    ++            NSRL CQI ++ E
Sbjct: 65  ACATCHVYVDEAWREKVGGPSPMEEDMLDFGYDVRP-----------NSRLSCQIKVSNE 113

Query: 147 LEGIEVTLPKATR 159
           L+G+ VT P+  R
Sbjct: 114 LDGLIVTTPERQR 126
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Length = 109 Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Length = 123 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Length = 103 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Length = 108 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Length = 113 Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Length = 106 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} Length = 104 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Length = 105 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Length = 106 Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Length = 111 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 99.96
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 99.96
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 99.96
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 99.96
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 99.95
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 99.94
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 99.94
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 99.93
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 99.93
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 99.93
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 99.88
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 99.87
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 99.78
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 99.77
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 99.77
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 99.77
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 99.77
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 99.75
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 99.75
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 99.75
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.7
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 99.68
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 99.63
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.52
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.58
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 98.25
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 98.22
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 98.17
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 97.67
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 97.58
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 97.53
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 97.53
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 97.28
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 96.94
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 96.93
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 96.45
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 96.36
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 96.17
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 96.05
3vr8_B 282 Iron-sulfur subunit of succinate dehydrogenase; me 95.99
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 94.67
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 92.81
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 90.17
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 84.99
3u7z_A101 Putative metal binding protein rumgna_00854; the b 83.71
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 82.87
2l05_A95 Serine/threonine-protein kinase B-RAF; structural 80.67
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.96  E-value=9.4e-30  Score=194.54  Aligned_cols=111  Identities=35%  Similarity=0.650  Sum_probs=102.9

Q ss_pred             CCCCCCceEEEEEcCCCCEEEEEecCCchHHHHHHHCCCC-CcCCCCCCccccccEEEEecCCccCCCCCChHHHhhccc
Q psy1435          38 PKSEDEIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIP-MEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDL  116 (171)
Q Consensus        38 p~~~~~mv~Vtfv~~~G~~~~v~~~~G~tLLdaa~~~gI~-i~~~CgG~G~CgtC~V~V~~g~~~~L~~~t~~E~~~L~~  116 (171)
                      -+.+++|++|+|++++|++++|++.+|+|||++|+++||+ +++.|+|.|.||+|+|+|.+|+++.++++++.|.++|+.
T Consensus        15 ~~~~~~M~~Vt~~~~~G~~~~v~~~~G~tLL~aa~~~gi~gi~~~C~G~G~CgtC~v~v~~G~~~~l~~~~~~E~~~L~~   94 (126)
T 3hui_A           15 VPRGSHMAKINFVDHTGETRTVEVEEGATVMEAAIRNAIPGVEAECGGACACATCHVYVDEAWREKVGGPSPMEEDMLDF   94 (126)
T ss_dssp             CCTTCSEEEEEEECTTSCEEEEEEETTSBHHHHHHTTTCTTCCCTTSSSSCCSTTEEEECGGGHHHHCCCCHHHHHHHTT
T ss_pred             cCCCCCceEEEEEeCCCCEEEEEECCCCcHHHHHHHcCCCCCccCCCCCCCCCCCEEEECCCcccccCCCCHHHhhhcCc
Confidence            3578899999999999988899999999999999999999 999999999999999999999888889999999999985


Q ss_pred             CCCCCCCeeeccccccCCCceeeeEEEecCCCceEEEeCCCcc
Q psy1435         117 APFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKATR  159 (171)
Q Consensus       117 ~~~~~~g~R~~~~~~~~~~RLACQ~~v~~dl~glvV~vp~~~~  159 (171)
                      +.++++|+|           ||||+++.+||||++|++|+.++
T Consensus        95 ~~e~~~g~R-----------LaCQ~~~~~dldgl~V~lp~~~r  126 (126)
T 3hui_A           95 GYDVRPNSR-----------LSCQIKVSNELDGLIVTTPERQR  126 (126)
T ss_dssp             SSSCCTTEE-----------EGGGCBCCGGGTTEEEECCSCCC
T ss_pred             hhhccCCeE-----------EeeeCEECcCCCcEEEEecCcCC
Confidence            457889999           99999999999999999998754
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>3u7z_A Putative metal binding protein rumgna_00854; the binding protein, transport protein, structural genomics, center for structural genomics; 1.30A {Ruminococcus gnavus} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d2bt6a1104 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [ 7e-28
d1b9ra_105 d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., 6e-26
d1e9ma_106 d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsu 1e-25
d1xlqa1106 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas 1e-25
d1i7ha_109 d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escheri 4e-20
d1l5pa_93 d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vagin 6e-19
d1krha3104 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, 8e-06
d1jq4a_98 d.15.4.2 (A:) Methane monooxygenase reductase N-te 1e-05
d2fug3395 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chai 1e-04
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: Adrenodoxin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 98.1 bits (244), Expect = 7e-28
 Identities = 41/115 (35%), Positives = 68/115 (59%), Gaps = 13/115 (11%)

Query: 43  EIVNITFIDKDGKRREIKGKVGDNVLYLAHRYEIPMEG--ACEASLACTTCHVYVKHEYL 100
           + + + FI++DG+    KGK+GD++L +  +  + ++G  ACE +LAC+TCH+  +    
Sbjct: 1   DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIF 60

Query: 101 DALPPAEEKEDDLLDLAPFLKDNSRLGCQNVMYNSRLGCQIILTKELEGIEVTLP 155
           + L    ++E+D+LDLA  L D S           RLGCQI LTK ++ + V +P
Sbjct: 61  EKLEAITDEENDMLDLAYGLTDRS-----------RLGCQICLTKAMDNMTVRVP 104
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Length = 105 Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Length = 106 Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Length = 106 Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Length = 109 Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Length = 93 Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Length = 104 Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Length = 98 Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 99.96
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 99.96
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 99.95
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 99.92
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 99.92
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 99.84
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 99.81
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.79
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 99.78
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.78
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 99.77
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 99.76
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 99.76
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 99.76
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 99.67
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 99.65
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 99.56
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.77
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.2
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.04
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 97.89
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.81
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 97.72
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 97.69
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 97.69
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 97.5
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 97.42
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 96.86
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 92.43
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 86.53
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 85.05
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 82.59
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 80.5
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin-related
domain: 2Fe-2S ferredoxin
species: Pseudomonas putida, putidaredoxin [TaxId: 303]

Probab=99.96  E-value=6.4e-30  Score=187.82  Aligned_cols=102  Identities=40%  Similarity=0.710  Sum_probs=94.6

Q ss_pred             EEEEEcCCCCEEEEEecCCchHHHHHHHCCCC-CcCCCCCCccccccEEEEecCCccCCCCCChHHHhhccc-CCCCCCC
Q psy1435          46 NITFIDKDGKRREIKGKVGDNVLYLAHRYEIP-MEGACEASLACTTCHVYVKHEYLDALPPAEEKEDDLLDL-APFLKDN  123 (171)
Q Consensus        46 ~Vtfv~~~G~~~~v~~~~G~tLLdaa~~~gI~-i~~~CgG~G~CgtC~V~V~~g~~~~L~~~t~~E~~~L~~-~~~~~~g  123 (171)
                      ||||++++|++++|++.+|+|||++|+++||+ +++.|||.|.||+|||+|.+|+.++++++++.|.++|+. +.++.++
T Consensus         2 KIt~i~~dG~~~~i~~~~G~tLl~aa~~~gi~~i~~~CgG~~~C~tC~V~v~~g~~~~l~~~~~~E~~~L~~~~~~~~~~   81 (106)
T d1xlqa1           2 KVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPN   81 (106)
T ss_dssp             EEEEECTTSCEEEEECCTTCBHHHHHHHTTCTTSCCTTCSSSSSCTTEEEECTTTGGGSCCCCHHHHHHHTTCSSCCCTT
T ss_pred             EEEEECCCCCEEEEEeCCCChHHHHHHHhCcCCchhhhhhccccccceEEecccchhcCCCCCHHHHHHHHhhhccCCCC
Confidence            79999999999999999999999999999995 999999999999999999999989999999999999975 3456788


Q ss_pred             eeeccccccCCCceeeeEEEecCCCceEEEeCCCc
Q psy1435         124 SRLGCQNVMYNSRLGCQIILTKELEGIEVTLPKAT  158 (171)
Q Consensus       124 ~R~~~~~~~~~~RLACQ~~v~~dl~glvV~vp~~~  158 (171)
                      +|           ||||+.+++||||++|+||+.+
T Consensus        82 sR-----------LaCQ~~v~~~~dgl~V~vPe~q  105 (106)
T d1xlqa1          82 SR-----------LCCQIIMTPELDGIVVDVPDRQ  105 (106)
T ss_dssp             EE-----------EGGGCBCCGGGTTEEEECCSCC
T ss_pred             cE-----------eeeeeEecccCCCEEEECCCcc
Confidence            88           9999999999999999999753
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure