Diaphorina citri psyllid: psy14373


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-----
MVFRILTHTQSLIQCQRVQSLRVPSAAKLNLHDFKFDDIHMEDDDTLKVRSNCGLCRSMPMSSVS
cEEEEEcccccHHHHHHcEEEECcccccEEEEEccccccccccccccEEEccccccccccccccc
MVFRILTHTQSLIQCQRVQSLRVPSAAKLNLHDFKFDDIHMEDDDTLKVRSNCGLCRSMPM****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFRILTHTQSLIQCQRVQSLRVPSAAKLNLHDFKFDDIHMEDDDTLKVRSNCGLCRSMPMSSVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides cAMP and cGMP. Catalyzes the hydrolysis of both cAMP and cGMP to 5'-AMP and 5'-GMP, respectively.confidentQ9VJ79

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046068 [BP]cGMP metabolic processprobableGO:0009187, GO:0034641, GO:0006807, GO:0019693, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0046058 [BP]cAMP metabolic processprobableGO:0009187, GO:0034641, GO:0006807, GO:0019693, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:1901564, GO:1901135, GO:0044237, GO:0006163, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ITU, chain A
Confidence level:probable
Coverage over the Query: 12-51
View the alignment between query and template
View the model in PyMOL