Diaphorina citri psyllid: psy14374


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MITAYHEGGHAVVAFFTKDSHPLHKVTHPLHKVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVREFVVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVRE
cCEEHHHHHHHHHHHHccccccccccccccEEEEEEEcccccEEEEEccccccccHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcc
MITAYHEGGHAVVAFFTKDSHPLHKVTHPLHKVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVREFVVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVRE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITAYHEGGHAVVAFFTKDSHPLHKVTHPLHKVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVREFVVTIIPRGVSLGHTAYIPEKERYHVTKSQLMAMMDTMMGGRAAEELVFGAEKVTSGASSDLVQATSIATHMVRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent zinc metalloprotease YME1L1 Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Seems to act in the processing of OPA1.confidentQ925S8
ATP-dependent zinc metalloprotease YME1L1 Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Seems to act in the processing of OPA1.confidentQ96TA2
ATP-dependent zinc metalloprotease FTSH 5, mitochondrial Probable ATP-dependent zinc metallopeptidase.confidentQ8LQJ8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0044257 [BP]cellular protein catabolic processprobableGO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0009056, GO:0009057
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0009535 [CC]chloroplast thylakoid membraneprobableGO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0044455 [CC]mitochondrial membrane partprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CE7, chain A
Confidence level:very confident
Coverage over the Query: 2-36,53-111
View the alignment between query and template
View the model in PyMOL
Template: 2CE7, chain A
Confidence level:very confident
Coverage over the Query: 53-111,128-180
View the alignment between query and template
View the model in PyMOL