Diaphorina citri psyllid: psy14379

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MQNIHIKHPIIPKCCLEMQDVLTIIRSFHVVGEEANNLDLSPDSGINDLQNLSPEEQEKQKAEWTQELARVEEEINTLKHVLASKTKTAQDLKKKLGFTVWKEFNDDLTQSIKNVKETQV
ccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHccc
***IHIKHPIIPKCCLEMQDVLTIIRSFHVVGEE*******************************QELARVEEEINTLKHVLASKTKTAQDLKKKLGFTVWKEFNDDLTQSI*N******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQNIHIKHPIIPKCCLEMQDVLTIIRSFHVVGEEANNLDLSPDSGINDLQNLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAQDLKKKLGFTVWKEFNDDLTQSIKNVKETQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YKH, chain B
Confidence level:probable
Coverage over the Query: 52-97
View the alignment between query and template
View the model in PyMOL