Diaphorina citri psyllid: psy14392


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
cHHHHHHHHHHHHccccCEEEcccccccEEEEEEECcccccccccccHHHHcccccccEEEEccEEEEEccccEEcccccccccccccEECcccccEEEEEEcccccEEEEEEEcEEEEEEEEcccccccCEEEccccHHHHHHHHHHHHHHHccccccccccc
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESF**GDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide deformylase Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.confidentO66847
Peptide deformylase Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.confidentA0M3P3
Peptide deformylase Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.confidentB1ZMD5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031365 [BP]N-terminal protein amino acid modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0035601 [BP]protein deacylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042586 [MF]peptide deformylase activityprobableGO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZXZ, chain A
Confidence level:very confident
Coverage over the Query: 1-156
View the alignment between query and template
View the model in PyMOL