Psyllid ID: psy14392

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
cHHHHHHHHHHHHccccEEEEcccccccEEEEEEEEccccccccccHHHHHHccccccEEEEccEEEEEccccEEcccccccccccccEEEcccccEEEEEEcccccEEEEEEEcEEEEEEEEcccccccEEEEccccHHHHHHHHHHHHHHHccccccccccc
cHHHHHHHHHHHHHccccEEEcccccccEEEEEEEcccccccccccccccccccccccEEEEccEEEEEEEEccEccEEcccccccccEEccEccEEEEEEEcccccEEEEEEcHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHcHHHccccccccccc
MKIIILQMKNVMKRFDlfglsapqvglpLRLFIvafpdpeesfsegdikkfemqafphmvwinpemkildYKDKVTALEGCASLKSLqakvpryrkvqltgldetgkpdswtaEGWAARIIQHEMDHLdgllftdsmlpksleCVCWQDINLQNGLLELRYYMS
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCAslkslqakvpryRKVQltgldetgkpdswTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
**IIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPE*SFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYY**
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESF********EMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDP******GDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRYYMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q9HBH1243 Peptide deformylase, mito yes N/A 0.865 0.584 0.425 4e-26
Q9FUZ0277 Peptide deformylase 1A, c N/A N/A 0.932 0.552 0.396 6e-23
B6RGY0260 Peptide deformylase 1A, c yes N/A 0.896 0.565 0.394 9e-23
Q9FV53269 Peptide deformylase 1A, c yes N/A 0.932 0.568 0.408 3e-22
Q9RRQ4232 Peptide deformylase OS=De yes N/A 0.719 0.508 0.404 4e-18
Q7NJV3227 Peptide deformylase 1 OS= yes N/A 0.810 0.585 0.370 1e-16
Q825U9224 Peptide deformylase 3 OS= yes N/A 0.737 0.540 0.403 3e-16
Q7NIF5187 Peptide deformylase 2 OS= no N/A 0.713 0.625 0.404 5e-16
Q7MT07189 Peptide deformylase OS=Po yes N/A 0.920 0.798 0.314 6e-16
B2RMJ1189 Peptide deformylase OS=Po yes N/A 0.920 0.798 0.314 7e-16
>sp|Q9HBH1|DEFM_HUMAN Peptide deformylase, mitochondrial OS=Homo sapiens GN=PDF PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 6/148 (4%)

Query: 7   QMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKF---EMQAFPHMVWIN 63
           ++  VM+R    GLSAPQ+G+P +  ++A   PE    E   ++    +M+ FP  V++N
Sbjct: 98  RLVQVMRRRRCVGLSAPQLGVPRQ--VLALELPEALCRECPPRQRALRQMEPFPLRVFVN 155

Query: 64  PEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQH 123
           P +++LD +  VT  EGC S+    A VPR++ VQ++GLD  G+   W A GWAARIIQH
Sbjct: 156 PSLRVLDSR-LVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQH 214

Query: 124 EMDHLDGLLFTDSMLPKSLECVCWQDIN 151
           EMDHL G LF D M  ++   V W  +N
Sbjct: 215 EMDHLQGCLFIDKMDSRTFTNVYWMKVN 242
Removes the formyl group from the N-terminal Met of newly synthesized proteins.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 8EC: 8
>sp|Q9FUZ0|DEF1A_SOLLC Peptide deformylase 1A, chloroplastic OS=Solanum lycopersicum GN=PDF1A PE=2 SV=1 Back     alignment and function description
>sp|B6RGY0|DEF1A_ORYSJ Peptide deformylase 1A, chloroplastic OS=Oryza sativa subsp. japonica GN=PDF1A PE=2 SV=1 Back     alignment and function description
>sp|Q9FV53|DEF1A_ARATH Peptide deformylase 1A, chloroplastic OS=Arabidopsis thaliana GN=PDF1A PE=1 SV=3 Back     alignment and function description
>sp|Q9RRQ4|DEF_DEIRA Peptide deformylase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=def PE=3 SV=1 Back     alignment and function description
>sp|Q7NJV3|DEF1_GLOVI Peptide deformylase 1 OS=Gloeobacter violaceus (strain PCC 7421) GN=def1 PE=3 SV=1 Back     alignment and function description
>sp|Q825U9|DEF3_STRAW Peptide deformylase 3 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=def3 PE=3 SV=1 Back     alignment and function description
>sp|Q7NIF5|DEF2_GLOVI Peptide deformylase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=def2 PE=3 SV=1 Back     alignment and function description
>sp|Q7MT07|DEF_PORGI Peptide deformylase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=def PE=3 SV=1 Back     alignment and function description
>sp|B2RMJ1|DEF_PORG3 Peptide deformylase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=def PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
193699878213 PREDICTED: peptide deformylase, mitochon 0.957 0.737 0.481 6e-39
91092264223 PREDICTED: similar to N-formylmethionyla 0.975 0.717 0.475 3e-34
321463123234 hypothetical protein DAPPUDRAFT_307445 [ 0.975 0.683 0.450 1e-33
347970782232 AGAP003861-PA [Anopheles gambiae str. PE 0.939 0.663 0.429 1e-33
170050375236 peptide deformylase, mitochondrial [Cule 0.981 0.682 0.397 5e-33
157127011243 N-formylmethionylaminoacyl-tRNA deformyl 0.981 0.662 0.398 1e-32
52345870239 peptide deformylase (mitochondrial) prec 0.908 0.623 0.430 4e-31
168693535240 peptide deformylase (mitochondrial) [Xen 0.908 0.620 0.423 3e-30
357613198162 hypothetical protein KGM_14914 [Danaus p 0.926 0.938 0.409 7e-30
195107440234 GI23900 [Drosophila mojavensis] gi|19391 0.981 0.688 0.380 1e-29
>gi|193699878|ref|XP_001950597.1| PREDICTED: peptide deformylase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 110/158 (69%), Gaps = 1/158 (0%)

Query: 4   IILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWIN 63
           +I  MK++MK+ +L GL+APQVG+P ++F++ FP P   FS+ +I    M+   + VWIN
Sbjct: 55  LIYIMKSLMKKSNLIGLAAPQVGIPFQIFVIHFPRPSHYFSKEEILLKGMEHVENQVWIN 114

Query: 64  PEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQH 123
           PE+K+L++ +KVT  E CAS K   A VPRY++V LTG+DE G+  +  A+ W ARI+QH
Sbjct: 115 PELKVLNH-EKVTFNESCASFKGYSADVPRYKRVLLTGIDENGEKKTLDAKEWTARIVQH 173

Query: 124 EMDHLDGLLFTDSMLPKSLECVCWQDINLQNGLLELRY 161
           EMDHL+G++++D M+  SL C  W  IN   G +ELRY
Sbjct: 174 EMDHLNGVMYSDRMVLNSLCCTGWHTINQFQGFVELRY 211

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91092264|ref|XP_967363.1| PREDICTED: similar to N-formylmethionylaminoacyl-tRNA deformylase, putative [Tribolium castaneum] gi|270001218|gb|EEZ97665.1| hypothetical protein TcasGA2_TC016210 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321463123|gb|EFX74141.1| hypothetical protein DAPPUDRAFT_307445 [Daphnia pulex] Back     alignment and taxonomy information
>gi|347970782|ref|XP_310421.4| AGAP003861-PA [Anopheles gambiae str. PEST] gi|333466829|gb|EAA06035.4| AGAP003861-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170050375|ref|XP_001861255.1| peptide deformylase, mitochondrial [Culex quinquefasciatus] gi|167872016|gb|EDS35399.1| peptide deformylase, mitochondrial [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157127011|ref|XP_001654759.1| N-formylmethionylaminoacyl-tRNA deformylase, putative [Aedes aegypti] gi|108884464|gb|EAT48689.1| AAEL000279-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|52345870|ref|NP_001004979.1| peptide deformylase (mitochondrial) precursor [Xenopus (Silurana) tropicalis] gi|49522476|gb|AAH75522.1| peptide deformylase like protein [Xenopus (Silurana) tropicalis] gi|89268627|emb|CAJ82379.1| peptide deformylase like protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|168693535|ref|NP_001108286.1| peptide deformylase (mitochondrial) [Xenopus laevis] gi|163916521|gb|AAI57494.1| LOC100137680 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|357613198|gb|EHJ68366.1| hypothetical protein KGM_14914 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195107440|ref|XP_001998320.1| GI23900 [Drosophila mojavensis] gi|193914914|gb|EDW13781.1| GI23900 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
UNIPROTKB|F1S391221 PDF "Uncharacterized protein" 0.896 0.665 0.436 1.3e-29
RGD|1582894231 Pdf "peptide deformylase (mito 0.896 0.636 0.436 1.2e-28
RGD|2321990255 LOC100363967 "peptide deformyl 0.896 0.576 0.436 1.2e-28
FB|FBgn0051278238 CG31278 [Drosophila melanogast 0.981 0.676 0.368 1.5e-28
UNIPROTKB|F1N5S7230 PDF "Uncharacterized protein" 0.896 0.639 0.416 1e-27
UNIPROTKB|J9NUA4245 PDF "Uncharacterized protein" 0.896 0.6 0.416 1.7e-27
ZFIN|ZDB-GENE-050913-42247 pdf "peptide deformylase (mito 0.890 0.591 0.413 2.2e-27
FB|FBgn0051373196 CG31373 [Drosophila melanogast 0.920 0.770 0.379 4e-26
UNIPROTKB|Q9HBH1243 PDF "Peptide deformylase, mito 0.865 0.584 0.425 2.9e-25
TAIR|locus:2037733269 PDF1A "peptide deformylase 1A" 0.932 0.568 0.408 2.6e-22
UNIPROTKB|F1S391 PDF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 1.3e-29, P = 1.3e-29
 Identities = 65/149 (43%), Positives = 96/149 (64%)

Query:     4 IILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKF-EMQAFPHMVWI 62
             ++ ++  VM+R    GLSAPQ+G+PL++  + FPD         +++  +M+ FP  V++
Sbjct:    73 LVQRLVQVMRRRHCVGLSAPQLGVPLQVLALEFPDALFHACAPRLREIRQMEPFPLHVFV 132

Query:    63 NPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQ 122
             NP +++LD +  VT  EGC S+    A VPR++ VQ++GLD  G+P  W A GWAARIIQ
Sbjct:   133 NPSLRVLDSR-LVTFPEGCESVAGFLACVPRFQAVQISGLDPRGEPVVWQASGWAARIIQ 191

Query:   123 HEMDHLDGLLFTDSMLPKSLECVCWQDIN 151
             HEMDHL GLLF D M  K+   + W ++N
Sbjct:   192 HEMDHLQGLLFIDKMDSKTFTNIHWMEVN 220
GO:0042586 "peptide deformylase activity" evidence=IEA
GO:0031365 "N-terminal protein amino acid modification" evidence=IEA
GO:0018206 "peptidyl-methionine modification" evidence=IEA
GO:0008284 "positive regulation of cell proliferation" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
RGD|1582894 Pdf "peptide deformylase (mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2321990 LOC100363967 "peptide deformylase-like protein-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0051278 CG31278 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5S7 PDF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUA4 PDF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-42 pdf "peptide deformylase (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0051373 CG31373 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HBH1 PDF "Peptide deformylase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2037733 PDF1A "peptide deformylase 1A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8AAP4DEF_BACTN3, ., 5, ., 1, ., 8, 80.34040.78040.6956yesN/A
O66847DEF_AQUAE3, ., 5, ., 1, ., 8, 80.34050.74390.7218yesN/A
A7NPM9DEF_ROSCS3, ., 5, ., 1, ., 8, 80.37410.81090.7189yesN/A
B1ZMD5DEF_OPITP3, ., 5, ., 1, ., 8, 80.34550.82310.7031yesN/A
Q8NQ46DEF1_CORGL3, ., 5, ., 1, ., 8, 80.35970.75600.7337yesN/A
Q0AXL3DEF_SYNWW3, ., 5, ., 1, ., 8, 80.33570.71340.7697yesN/A
Q7W0Q0DEF1_BORPE3, ., 5, ., 1, ., 8, 80.33830.75600.7045yesN/A
Q5LEQ9DEF_BACFN3, ., 5, ., 1, ., 8, 80.32850.78650.7010yesN/A
Q64VP5DEF_BACFR3, ., 5, ., 1, ., 8, 80.32850.78650.7010yesN/A
Q7W4K0DEF2_BORPA3, ., 5, ., 1, ., 8, 80.33830.75600.7045yesN/A
B1I504DEF_DESAP3, ., 5, ., 1, ., 8, 80.35380.68290.7272yesN/A
Q6AQ98DEF_DESPS3, ., 5, ., 1, ., 8, 80.38330.64630.6272yesN/A
Q7MT07DEF_PORGI3, ., 5, ., 1, ., 8, 80.31480.92070.7989yesN/A
Q9PK41DEF_CHLMU3, ., 5, ., 1, ., 8, 80.35910.79260.7182yesN/A
B5YIL7DEF_THEYD3, ., 5, ., 1, ., 8, 80.36020.73780.7333yesN/A
A5CF65DEF_ORITB3, ., 5, ., 1, ., 8, 80.38980.68900.6243yesN/A
Q8XJL2DEF1_CLOPE3, ., 5, ., 1, ., 8, 80.36230.73170.8163yesN/A
A6L7J9DEF_BACV83, ., 5, ., 1, ., 8, 80.34780.77430.6902yesN/A
B2RMJ1DEF_PORG33, ., 5, ., 1, ., 8, 80.31480.92070.7989yesN/A
O83738DEF_TREPA3, ., 5, ., 1, ., 8, 80.35710.73780.7469yesN/A
A0M3P3DEF_GRAFK3, ., 5, ., 1, ., 8, 80.31970.85970.7193yesN/A
B3CTU1DEF_ORITI3, ., 5, ., 1, ., 8, 80.38980.68900.6243yesN/A
Q7UHZ5DEF_RHOBA3, ., 5, ., 1, ., 8, 80.35210.77430.6318yesN/A
Q7WG25DEF2_BORBR3, ., 5, ., 1, ., 8, 80.33830.75600.7045yesN/A
B3EPG5DEF_CHLPB3, ., 5, ., 1, ., 8, 80.35480.82310.7297yesN/A
Q7V8G6DEF1_PROMM3, ., 5, ., 1, ., 8, 80.33330.77430.6614yesN/A
Q8XZJ6DEF2_RALSO3, ., 5, ., 1, ., 8, 80.34580.75600.7005yesN/A
B2KD65DEF_ELUMP3, ., 5, ., 1, ., 8, 80.36490.77430.7215yesN/A
B2S3Z6DEF_TREPS3, ., 5, ., 1, ., 8, 80.35710.73780.7469yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.10.691
3rd Layer3.5.1.880.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd00487141 cd00487, Pep_deformylase, Polypeptide or peptide d 3e-41
pfam01327155 pfam01327, Pep_deformylase, Polypeptide deformylas 3e-41
COG0242168 COG0242, Def, N-formylmethionyl-tRNA deformylase [ 2e-34
PRK00150165 PRK00150, def, peptide deformylase; Reviewed 4e-34
PRK12846165 PRK12846, PRK12846, peptide deformylase; Reviewed 2e-29
PRK14596199 PRK14596, PRK14596, peptide deformylase; Provision 4e-24
PRK14597166 PRK14597, PRK14597, peptide deformylase; Provision 9e-23
TIGR00079161 TIGR00079, pept_deformyl, peptide deformylase 7e-20
PRK14598187 PRK14598, PRK14598, peptide deformylase; Provision 8e-20
PRK09218136 PRK09218, PRK09218, peptide deformylase; Validated 7e-14
PRK14595162 PRK14595, PRK14595, peptide deformylase; Provision 2e-08
>gnl|CDD|238271 cd00487, Pep_deformylase, Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information 
 Score =  134 bits (340), Expect = 3e-41
 Identities = 48/130 (36%), Positives = 67/130 (51%), Gaps = 14/130 (10%)

Query: 4   IILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWIN 63
           +I  M   M      GL+APQ+G+  R+F++  PD E                P +V IN
Sbjct: 26  LIDDMFETMYAAPGVGLAAPQIGVSKRIFVIDVPDEEN-------------KEPPLVLIN 72

Query: 64  PEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQH 123
           PE+      +     EGC S+   + +V R +KV +  LDE G P    AEG+ AR IQH
Sbjct: 73  PEIIESS-GETEYGEEGCLSVPGYRGEVERPKKVTVRYLDEDGNPIELEAEGFLARCIQH 131

Query: 124 EMDHLDGLLF 133
           E+DHL+G+LF
Sbjct: 132 EIDHLNGILF 141

These enzymes utilize Fe(II) as the catalytic metal ion, which can be replaced with a nickel or cobalt ion with no loss of activity. There are two types of peptide deformylases, types I and II, which differ in structure only in the outer surface of the domain. Because these enzymes are essential only in prokaryotes (although eukaryotic gene sequences have been found), they are a target for a new class of antibacterial agents. Length = 141
>gnl|CDD|216435 pfam01327, Pep_deformylase, Polypeptide deformylase Back     alignment and domain information
>gnl|CDD|223320 COG0242, Def, N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234668 PRK00150, def, peptide deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|237227 PRK12846, PRK12846, peptide deformylase; Reviewed Back     alignment and domain information
>gnl|CDD|184758 PRK14596, PRK14596, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|237761 PRK14597, PRK14597, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|232815 TIGR00079, pept_deformyl, peptide deformylase Back     alignment and domain information
>gnl|CDD|237762 PRK14598, PRK14598, peptide deformylase; Provisional Back     alignment and domain information
>gnl|CDD|181704 PRK09218, PRK09218, peptide deformylase; Validated Back     alignment and domain information
>gnl|CDD|184757 PRK14595, PRK14595, peptide deformylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
COG0242168 Def N-formylmethionyl-tRNA deformylase [Translatio 100.0
PRK12846165 peptide deformylase; Reviewed 100.0
PRK14595162 peptide deformylase; Provisional 100.0
PRK14597166 peptide deformylase; Provisional 100.0
PRK14598187 peptide deformylase; Provisional 100.0
PRK00150165 def peptide deformylase; Reviewed 100.0
TIGR00079161 pept_deformyl peptide deformylase. Peptide deformy 100.0
PF01327156 Pep_deformylase: Polypeptide deformylase; InterPro 100.0
cd00487141 Pep_deformylase Polypeptide or peptide deformylase 100.0
PRK14596199 peptide deformylase; Provisional 100.0
KOG3137|consensus267 100.0
PRK09218136 peptide deformylase; Validated 100.0
COG4740176 Predicted metalloprotease [General function predic 98.16
>COG0242 Def N-formylmethionyl-tRNA deformylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=3.8e-54  Score=337.33  Aligned_cols=137  Identities=34%  Similarity=0.549  Sum_probs=121.7

Q ss_pred             CHHHHHHHHHHHHhCCCeeEecccCCccceEEEEEcCCCCCCCcchhhhhhhcccCCcEEEEeceEEEecCceeeeCeeC
Q psy14392          1 MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEG   80 (164)
Q Consensus         1 ~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vv~~~~~~~~~~~~~~~~~~~~~~~~~v~INP~I~~~s~e~~~~~~Eg   80 (164)
                      +++|++||++||++++|+||||||||+++|+|||+++....            +..++.+||||+|++.|++ ..+.+||
T Consensus        28 l~~li~dM~etm~~~~GVGLAApQIGi~kri~vi~~~~~~~------------~~~~~~vlINP~I~~~~~~-~~~~~EG   94 (168)
T COG0242          28 LRQLIDDMLETMYAAEGVGLAAPQIGISKRIFVIDVEEDGR------------PKEPPLVLINPEIISKSEE-TLTGEEG   94 (168)
T ss_pred             HHHHHHHHHHHHHhCCCeeeeehhcCceeeEEEEEccCccC------------cCcCceEEECCEEeecCCc-ccccCcc
Confidence            47899999999999999999999999999999999976421            0123589999999998777 8899999


Q ss_pred             CCCcCCCccccccCCeeEEEEECCCCCeEEEEEechhhhhHhhhhhhhCCeeeeeccCccccccchhhhh
Q psy14392         81 CASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDI  150 (164)
Q Consensus        81 CLS~pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~  150 (164)
                      |||+||+++.|+||.+|+|+|+|++|++++++++||+|||+|||+|||||+||+||+++.+.+.+.-+..
T Consensus        95 CLSvP~~~~~V~R~~~I~V~~~D~~G~~~~~~a~G~lA~~iQHEiDHLnGvlf~D~l~~~k~~~~~~~~~  164 (168)
T COG0242          95 CLSVPGVRGEVERPERITVKYLDRNGKPQELEAEGLLARCIQHEIDHLNGVLFIDRLSPLKRDRLKKKLK  164 (168)
T ss_pred             eEeecCceeeeecccEEEEEEEcCCCCEEEEEEcCceeEEeEeeccccCcEEeeeecChhhhhhHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999855544444433

>PRK12846 peptide deformylase; Reviewed Back     alignment and domain information
>PRK14595 peptide deformylase; Provisional Back     alignment and domain information
>PRK14597 peptide deformylase; Provisional Back     alignment and domain information
>PRK14598 peptide deformylase; Provisional Back     alignment and domain information
>PRK00150 def peptide deformylase; Reviewed Back     alignment and domain information
>TIGR00079 pept_deformyl peptide deformylase Back     alignment and domain information
>PF01327 Pep_deformylase: Polypeptide deformylase; InterPro: IPR023635 Peptide deformylase (PDF) is an essential metalloenzyme required for the removal of the formyl group at the N terminus of nascent polypeptide chains in eubacteria: 3 Back     alignment and domain information
>cd00487 Pep_deformylase Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes Back     alignment and domain information
>PRK14596 peptide deformylase; Provisional Back     alignment and domain information
>KOG3137|consensus Back     alignment and domain information
>PRK09218 peptide deformylase; Validated Back     alignment and domain information
>COG4740 Predicted metalloprotease [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3g5k_A183 Structure And Activity Of Human Mitochondrial Pepti 2e-27
1zxz_A197 X-Ray Structure Of Peptide Deformylase From Arabido 3e-23
3m6r_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 7e-16
4dr9_A192 Crystal Structure Of A Peptide Deformylase From Syn 1e-15
3m6q_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 2e-15
3m6o_A193 Crystal Structure Of Arabidopsis Thaliana Peptide D 3e-15
3cpm_A193 Plant Peptide Deformylase Pdf1b Crystal Structure L 3e-15
1v3y_A192 The Crystal Structure Of Peptide Deformylase From T 4e-14
3uwa_A154 Crystal Structure Of A Probable Peptide Deformylase 8e-14
4az4_A186 E.Coli Deformylase With Co(Ii) And Hydrosulfide Len 2e-13
3k6l_A169 The Structure Of E.Coli Peptide Deformylase (Pdf) I 2e-13
1dff_A164 Peptide Deformylase Length = 164 2e-13
1icj_A168 Pdf Protein Is Crystallized As Ni2+ Containing Form 2e-13
4al2_A186 Peptide Deformylase (Ni-Form) With Hydrosulfide Len 2e-13
3dld_A171 Crystal Structure Of Peptide Deformylase, Xoo1075, 2e-13
2w3t_A188 Chloro Complex Of The Ni-Form Of E.Coli Deformylase 2e-13
1def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 7e-13
2def_A147 Peptide Deformylase Catalytic Core (Residues 1-147) 7e-13
1y6h_A177 Crystal Structure Of Lipdf Length = 177 2e-12
1szz_A177 Crystal Structure Of Peptide Deformylase From Lepto 3e-12
3u04_A190 Crystal Structure Of Peptide Deformylase From Ehrli 3e-12
3oca_A209 Crystal Structure Of Peptide Deformylase From Ehrli 4e-12
4al3_A186 Peptide Deformylase (Co-Form) With Mercaptoethanol 4e-12
1lme_A176 Crystal Structure Of Peptide Deformylase From Therm 1e-11
3qu1_A171 Peptide Deformylase From Vibrio Cholerae Length = 1 2e-11
3e3u_A197 Crystal Structure Of Mycobacterium Tuberculosis Pep 7e-11
1ix1_A171 Crystal Structure Of P.Aeruginosa Peptide Deformyla 1e-10
1lry_A167 Crystal Structure Of P. Aeruginosa Peptide Deformyl 1e-10
2ew5_A181 Structure Of Helicobacter Pylori Peptide Deformylas 2e-10
1n5n_A180 Crystal Structure Of Peptide Deformylase From Pseud 5e-10
1ws0_A156 Structure Analysis Of Peptide Deformylase From Baci 6e-10
1rl4_A188 Plasmodium Falciparum Peptide Deformylase Complex W 7e-10
3fwx_A169 The Crystal Structure Of The Peptide Deformylase Fr 9e-10
2os3_A205 Structures Of Actinonin Bound Peptide Deformylases 9e-09
2ai7_A203 S.Pneumoniae Polypeptide Deformylase Complexed With 1e-08
1lqw_A183 Crystal Structure Of S.Aureus Peptide Deformylase L 1e-08
2aie_P203 S.Pneumoniae Polypeptide Deformylase Complexed With 1e-08
3str_P203 Strep Peptide Deformylase With A Time Dependent Thi 1e-08
1rqc_A185 Crystals Of Peptide Deformylase From Plasmodium Fal 1e-08
2okl_A185 Crystal Structure Of Peptide Deformylase 2 With Act 4e-08
1lmh_A184 Crystal Structure Of S. Aureus Peptide Deformylase 5e-08
3l87_A238 The Crystal Structure Of Smu.143c From Streptococcu 1e-07
2os1_A188 Structures Of Actinonin Bound Peptide Deformylases 1e-07
2os0_A188 Structures Of Actinonin Bound Peptide Deformylases 1e-07
1jym_A183 Crystals Of Peptide Deformylase From Plasmodium Fal 2e-07
1lqy_A184 Crystal Structure Of Bacillus Stearothermophilus Pe 2e-07
3g6n_A191 Crystal Structure Of An Efpdf Complex With Met-Ala- 2e-07
3cmd_A196 Crystal Structure Of Peptide Deformylase From Vre-E 2e-07
1q1y_A191 Crystal Structures Of Peptide Deformylase From Stap 3e-07
3svj_P203 Strep Peptide Deformylase With A Time Dependent Thi 3e-07
1lm4_A194 Structure Of Peptide Deformylase From Staphylococcu 3e-07
1lm6_A215 Crystal Structure Of Peptide Deformylase From Strep 3e-07
>pdb|3G5K|A Chain A, Structure And Activity Of Human Mitochondrial Peptide Deformylase, A Novel Cancer Target Length = 183 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 63/148 (42%), Positives = 90/148 (60%), Gaps = 6/148 (4%)
Query: 7   QMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKF---EMQAFPHMVWIN 63
           ++  VM+R    GLSAPQ+G+P +  ++A   PE    E   ++    +M+ FP  V++N
Sbjct: 38  RLVQVMRRRRCVGLSAPQLGVPRQ--VLALELPEALCRECPPRQRALRQMEPFPLRVFVN 95
Query: 64  PEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQH 123
           P +++LD +  VT  EGC S+    A VPR++ VQ++GLD  G+   W A GWAARIIQH
Sbjct: 96  PSLRVLDSR-LVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQH 154
Query: 124 EMDHLDGLLFTDSMLPKSLECVCWQDIN 151
           EMDHL G LF D M  ++   V W  +N
Sbjct: 155 EMDHLQGCLFIDKMDSRTFTNVYWMKVN 182
>pdb|1ZXZ|A Chain A, X-Ray Structure Of Peptide Deformylase From Arabidopsis Thaliana (Atpdf1a); Crystals Grown In Peg-5000 Mme As Precipitant Length = 197 Back     alignment and structure
>pdb|3M6R|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41m Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|4DR9|A Chain A, Crystal Structure Of A Peptide Deformylase From Synechococcus Elongatus In Complex With Actinonin Length = 192 Back     alignment and structure
>pdb|3M6Q|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) G41q Mutant In Complex With Actinonin Length = 193 Back     alignment and structure
>pdb|3M6O|A Chain A, Crystal Structure Of Arabidopsis Thaliana Peptide Deformylase 1b (Atpdf1b) Length = 193 Back     alignment and structure
>pdb|3CPM|A Chain A, Plant Peptide Deformylase Pdf1b Crystal Structure Length = 193 Back     alignment and structure
>pdb|1V3Y|A Chain A, The Crystal Structure Of Peptide Deformylase From Thermus Thermophilus Hb8 Length = 192 Back     alignment and structure
>pdb|3UWA|A Chain A, Crystal Structure Of A Probable Peptide Deformylase From Synechococcus Phage S-Ssm7 Length = 154 Back     alignment and structure
>pdb|4AZ4|A Chain A, E.Coli Deformylase With Co(Ii) And Hydrosulfide Length = 186 Back     alignment and structure
>pdb|3K6L|A Chain A, The Structure Of E.Coli Peptide Deformylase (Pdf) In Complex With Peptidomimetic Ligand Bb2827 Length = 169 Back     alignment and structure
>pdb|1DFF|A Chain A, Peptide Deformylase Length = 164 Back     alignment and structure
>pdb|1ICJ|A Chain A, Pdf Protein Is Crystallized As Ni2+ Containing Form, Cocrystallized With Inhibitor Polyethylene Glycol (Peg) Length = 168 Back     alignment and structure
>pdb|4AL2|A Chain A, Peptide Deformylase (Ni-Form) With Hydrosulfide Length = 186 Back     alignment and structure
>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 171 Back     alignment and structure
>pdb|2W3T|A Chain A, Chloro Complex Of The Ni-Form Of E.Coli Deformylase Length = 188 Back     alignment and structure
>pdb|1DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 9 Structures Length = 147 Back     alignment and structure
>pdb|2DEF|A Chain A, Peptide Deformylase Catalytic Core (Residues 1-147), Nmr, 20 Structures Length = 147 Back     alignment and structure
>pdb|1Y6H|A Chain A, Crystal Structure Of Lipdf Length = 177 Back     alignment and structure
>pdb|1SZZ|A Chain A, Crystal Structure Of Peptide Deformylase From Leptospira Interrogans Complexed With Inhibitor Actinonin Length = 177 Back     alignment and structure
>pdb|3U04|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis In Complex With Actinonin Length = 190 Back     alignment and structure
>pdb|3OCA|A Chain A, Crystal Structure Of Peptide Deformylase From Ehrlichia Chaffeensis Length = 209 Back     alignment and structure
>pdb|4AL3|A Chain A, Peptide Deformylase (Co-Form) With Mercaptoethanol Length = 186 Back     alignment and structure
>pdb|1LME|A Chain A, Crystal Structure Of Peptide Deformylase From Thermotoga Maritima Length = 176 Back     alignment and structure
>pdb|3QU1|A Chain A, Peptide Deformylase From Vibrio Cholerae Length = 171 Back     alignment and structure
>pdb|3E3U|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Peptide Deformylase In Complex With Inhibitor Length = 197 Back     alignment and structure
>pdb|1IX1|A Chain A, Crystal Structure Of P.Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 171 Back     alignment and structure
>pdb|1LRY|A Chain A, Crystal Structure Of P. Aeruginosa Peptide Deformylase Complexed With Antibiotic Actinonin Length = 167 Back     alignment and structure
>pdb|2EW5|A Chain A, Structure Of Helicobacter Pylori Peptide Deformylase In Complex With Inhibitor Length = 181 Back     alignment and structure
>pdb|1N5N|A Chain A, Crystal Structure Of Peptide Deformylase From Pseudomonas Aeruginosa Length = 180 Back     alignment and structure
>pdb|1WS0|A Chain A, Structure Analysis Of Peptide Deformylase From Bacillus Cereus Length = 156 Back     alignment and structure
>pdb|1RL4|A Chain A, Plasmodium Falciparum Peptide Deformylase Complex With Inhibitor Length = 188 Back     alignment and structure
>pdb|3FWX|A Chain A, The Crystal Structure Of The Peptide Deformylase From Vibrio Cholerae O1 Biovar El Tor Str. N16961 Length = 169 Back     alignment and structure
>pdb|2OS3|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 205 Back     alignment and structure
>pdb|2AI7|A Chain A, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 485345 Length = 203 Back     alignment and structure
>pdb|1LQW|A Chain A, Crystal Structure Of S.Aureus Peptide Deformylase Length = 183 Back     alignment and structure
>pdb|2AIE|P Chain P, S.Pneumoniae Polypeptide Deformylase Complexed With Sb- 505684 Length = 203 Back     alignment and structure
>pdb|3STR|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Hydroxamic Acid Length = 203 Back     alignment and structure
>pdb|1RQC|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 185 Back     alignment and structure
>pdb|2OKL|A Chain A, Crystal Structure Of Peptide Deformylase 2 With Actinonin From Bacillus Cereus Length = 185 Back     alignment and structure
>pdb|1LMH|A Chain A, Crystal Structure Of S. Aureus Peptide Deformylase Length = 184 Back     alignment and structure
>pdb|3L87|A Chain A, The Crystal Structure Of Smu.143c From Streptococcus Mutans Ua159 Length = 238 Back     alignment and structure
>pdb|2OS1|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|2OS0|A Chain A, Structures Of Actinonin Bound Peptide Deformylases From E. Faecalis And S. Pyogenes Length = 188 Back     alignment and structure
>pdb|1JYM|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum With Ten Subunits Per Asymmetric Unit Reveal Critical Characteristics Of The Active Site For Drug Design Length = 183 Back     alignment and structure
>pdb|1LQY|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Peptide Deformylase Complexed With Antibiotic Actinonin Length = 184 Back     alignment and structure
>pdb|3G6N|A Chain A, Crystal Structure Of An Efpdf Complex With Met-Ala-Ser Length = 191 Back     alignment and structure
>pdb|3CMD|A Chain A, Crystal Structure Of Peptide Deformylase From Vre-E.Faecium Length = 196 Back     alignment and structure
>pdb|1Q1Y|A Chain A, Crystal Structures Of Peptide Deformylase From Staphylococcus Aureus Complexed With Actinonin Length = 191 Back     alignment and structure
>pdb|3SVJ|P Chain P, Strep Peptide Deformylase With A Time Dependent Thiazolidine Amide Length = 203 Back     alignment and structure
>pdb|1LM4|A Chain A, Structure Of Peptide Deformylase From Staphylococcus Aureus At 1.45 A Length = 194 Back     alignment and structure
>pdb|1LM6|A Chain A, Crystal Structure Of Peptide Deformylase From Streptococcus Pneumoniae Length = 215 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 2e-48
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 2e-43
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 4e-36
1y6h_A177 Peptide deformylase; open and close conformation, 2e-35
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 7e-33
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 1e-32
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 1e-31
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 3e-31
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 1e-30
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 1e-30
1rl4_A188 Formylmethionine deformylase; crystal engineering, 3e-30
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 2e-29
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 4e-29
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 9e-29
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 1e-28
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 2e-28
3qu1_A171 Peptide deformylase 2; structural genomics, center 2e-28
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 3e-28
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 3e-28
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 7e-28
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 8e-27
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Length = 183 Back     alignment and structure
 Score =  153 bits (389), Expect = 2e-48
 Identities = 60/149 (40%), Positives = 85/149 (57%), Gaps = 2/149 (1%)

Query: 4   IILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFP-DPEESFSEGDIKKFEMQAFPHMVWI 62
           +  ++  VM+R    GLSAPQ+G+P ++  +  P               +M+ FP  V++
Sbjct: 35  LTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFV 94

Query: 63  NPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQ 122
           NP +++LD    VT  EGC S+    A VPR++ VQ++GLD  G+   W A GWAARIIQ
Sbjct: 95  NPSLRVLD-SRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQ 153

Query: 123 HEMDHLDGLLFTDSMLPKSLECVCWQDIN 151
           HEMDHL G LF D M  ++   V W  +N
Sbjct: 154 HEMDHLQGCLFIDKMDSRTFTNVYWMKVN 182
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Length = 197 Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} Length = 171 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Length = 177 Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Length = 192 Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Length = 238 Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} PDB: 3str_P* 3sw8_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Length = 203 Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Length = 197 Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Length = 188 Back     alignment and structure
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Length = 193 Back     alignment and structure
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Length = 188 Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Length = 156 Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Length = 181 Back     alignment and structure
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} PDB: 3oca_A Length = 190 Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Length = 176 Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Length = 194 Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} Length = 171 Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Length = 168 Back     alignment and structure
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Length = 188 Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Length = 185 Back     alignment and structure
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3g5k_A183 Peptide deformylase, mitochondrial; actinonin, hyd 100.0
4dr9_A192 Peptide deformylase; hydrolase-hydrolase inhibitor 100.0
3u04_A190 Peptide deformylase 1; ssgcid, actinonin, ehrlichi 100.0
1xeo_A168 Peptide deformylase; cobalt deformylase, formate, 100.0
1lme_A176 PDF, peptide deformylase; thermophIle, metalloenzy 100.0
3pn3_A193 Peptide deformylase 1B, chloroplastic; PDF, N-term 100.0
3qu1_A171 Peptide deformylase 2; structural genomics, center 100.0
1n5n_A180 Peptide deformylase; metalloenzyme, drug design, d 100.0
3uwb_A154 RIIA-RIIB membrane-associated protein; actinonin, 100.0
3dld_A171 Peptide deformylase; bacterial blight, XOO1075, xa 100.0
1y6h_A177 Peptide deformylase; open and close conformation, 100.0
1zxz_A197 PDF, peptide deformylase, mitochondrial; PDF1A, eu 100.0
3e3u_A197 Peptide deformylase; metallo-enzyme, hydrolase, ir 100.0
2ew5_A181 Peptide deformylase; inhibitor, hydrolase; HET: Y1 100.0
1rl4_A188 Formylmethionine deformylase; crystal engineering, 100.0
1ws0_A156 Peptide deformylase 1; alpha + beta topology, hydr 100.0
2w3t_A188 Peptide deformylase; protein biosynthesis, iron, n 100.0
1v3y_A192 Peptide deformylase; protein synthesis, riken stru 100.0
2okl_A185 Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1. 100.0
2os0_A188 Peptide deformylase; PDF, hydrolase; 1.30A {Entero 100.0
1lm4_A194 Peptide deformylase PDF1; metalloenzyme, hydrolase 100.0
3svj_P203 Peptide deformylase 3; alpha-beta, metal binding p 100.0
3l87_A238 Peptide deformylase; hydrolase, iron, metal-bindin 100.0
>3g5k_A Peptide deformylase, mitochondrial; actinonin, hydrolase, iron, metal-bindi mitochondrion, protein biosynthesis, transit peptide; HET: BB2; 1.70A {Homo sapiens} PDB: 3g5p_A Back     alignment and structure
Probab=100.00  E-value=2.9e-58  Score=364.71  Aligned_cols=150  Identities=40%  Similarity=0.746  Sum_probs=130.5

Q ss_pred             CHHHHHHHHHHHHhCCCeeEecccCCccceEEEEEcCCCC-CCCcchhhhhhhcccCCcEEEEeceEEEecCceeeeCee
Q psy14392          1 MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPE-ESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALE   79 (164)
Q Consensus         1 ~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vv~~~~~~-~~~~~~~~~~~~~~~~~~~v~INP~I~~~s~e~~~~~~E   79 (164)
                      +++|++||++||++++|+||||||||+++|+||++.++.. ..++++....+++.+.++.+||||+|+..|.+ +..++|
T Consensus        32 l~~Li~dM~eTM~~~~GvGLAApQIGv~~Ri~vid~~~~~~~~~~~~~~~~~~~~~~~~~vlINP~I~~~s~~-~~~~~E  110 (183)
T 3g5k_A           32 LQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSR-LVTFPE  110 (183)
T ss_dssp             HHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEEEECHHHHHTSCHHHHHHHTCCCEEEEEEEEEEEEEEEEE-EEEEEE
T ss_pred             HHHHHHHHHHHHHHcCCeEEeccccCCceeEEEEEcCccccccccccccccccccccCceEEECCeEEecCCC-EEeccc
Confidence            4789999999999999999999999999999999986431 11111111112223334679999999998887 888999


Q ss_pred             CCCCcCCCccccccCCeeEEEEECCCCCeEEEEEechhhhhHhhhhhhhCCeeeeeccCccccccchhhhhh
Q psy14392         80 GCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDIN  151 (164)
Q Consensus        80 gCLS~pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~~  151 (164)
                      ||||+||+++.|+||.+|+|+|+|++|++++++++||+|||+|||+|||+|+||+|||++++|.+.+|+.+|
T Consensus       111 GCLSvPg~~~~V~R~~~I~V~~~D~~G~~~~~~~~G~~Ar~iQHEiDHL~GiLfiDrl~~~s~~~~~w~~~~  182 (183)
T 3g5k_A          111 GCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVN  182 (183)
T ss_dssp             CCTTSTTEEEEEEEEEEEEEEEECTTSCEEEEEEEHHHHHHHHHHHHHHTTCCGGGTSCGGGCEETTCCCCC
T ss_pred             CccCcCCccEEeeCcceeEEEEECCCCCEEEEEEeChhheehhhHHHHhCCEeEEEEeCHHHhCccceeEcc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999876
>4dr9_A Peptide deformylase; hydrolase-hydrolase inhibitor complex; HET: BB2; 1.90A {Synechococcus elongatus} Back     alignment and structure
>3u04_A Peptide deformylase 1; ssgcid, actinonin, ehrlichia chaffeensi structural genomics; HET: BB2; 1.70A {Ehrlichia chaffeensis} SCOP: d.167.1.0 PDB: 3oca_A Back     alignment and structure
>1xeo_A Peptide deformylase; cobalt deformylase, formate, hydrolase; 1.30A {Escherichia coli} SCOP: d.167.1.1 PDB: 1bs5_A 1bs6_A 1bs7_A 1bs8_A 1bsj_A* 1bsk_A* 1bsz_A* 1g27_A* 1bs4_A* 1icj_A* 1lru_A* 1xem_A 1xen_A 1g2a_A 2ai8_A* 4al3_A 4al2_A 3k6l_A* 1dff_A 1def_A ... Back     alignment and structure
>1lme_A PDF, peptide deformylase; thermophIle, metalloenzyme, deformylation, structural genomics, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.167.1.1 Back     alignment and structure
>3pn3_A Peptide deformylase 1B, chloroplastic; PDF, N-terminal excision pathway, N induced-FIT, hydrolase-hydrolase inhibitor complex; HET: PN3; 1.30A {Arabidopsis thaliana} PDB: 3m6p_A* 3o3j_A* 3pn2_A 3m6o_A* 3pn4_A* 3pn5_A 3m6q_A 3pn6_A 3m6r_A 3cpm_A Back     alignment and structure
>3qu1_A Peptide deformylase 2; structural genomics, center for structural genomics of infec diseases, csgid, metal binding; 1.80A {Vibrio cholerae} SCOP: d.167.1.0 Back     alignment and structure
>1n5n_A Peptide deformylase; metalloenzyme, drug design, deformylation, hydrolase; 1.80A {Pseudomonas aeruginosa} SCOP: d.167.1.1 PDB: 1s17_A* 1ix1_A* 1lry_A* Back     alignment and structure
>3uwb_A RIIA-RIIB membrane-associated protein; actinonin, probable peptide deformylase hydrolase-antibiotic complex; HET: BB2; 1.70A {Synechococcus phage s-ssm7} PDB: 3uwa_A* Back     alignment and structure
>3dld_A Peptide deformylase; bacterial blight, XOO1075, xanthomonas oryzae PV. oryzae KACC10331, hydrolase; 2.60A {Xanthomonas oryzae PV} SCOP: d.167.1.0 Back     alignment and structure
>1y6h_A Peptide deformylase; open and close conformation, PDF, hydrolase; 2.20A {Leptospira interrogans} SCOP: d.167.1.1 PDB: 1sv2_A* 1vey_A* 1vev_A 1vez_A 1szz_A* Back     alignment and structure
>1zxz_A PDF, peptide deformylase, mitochondrial; PDF1A, eukaryote, higher plant, zinc ION, hydrolase; 2.80A {Arabidopsis thaliana} PDB: 1zy0_A 1zy1_A Back     alignment and structure
>3e3u_A Peptide deformylase; metallo-enzyme, hydrolase, iron, metal-binding, protein biosynthesis; HET: NVC; 1.56A {Mycobacterium tuberculosis} Back     alignment and structure
>2ew5_A Peptide deformylase; inhibitor, hydrolase; HET: Y12; 2.20A {Helicobacter pylori} PDB: 2ew6_A* 2ew7_A Back     alignment and structure
>1rl4_A Formylmethionine deformylase; crystal engineering, drug design, malaria, PDF, peptide DEFO plasmodium, hydrolase; HET: BRR BL5; 2.18A {Plasmodium falciparum} SCOP: d.167.1.1 PDB: 1rqc_A 1jym_A Back     alignment and structure
>1ws0_A Peptide deformylase 1; alpha + beta topology, hydrolase; 1.70A {Bacillus cereus} PDB: 1ws1_A* Back     alignment and structure
>2w3t_A Peptide deformylase; protein biosynthesis, iron, nickel, hydrolase, metal-binding; 1.69A {Escherichia coli} PDB: 2w3u_A Back     alignment and structure
>1v3y_A Peptide deformylase; protein synthesis, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.81A {Thermus thermophilus} SCOP: d.167.1.1 Back     alignment and structure
>2okl_A Peptide deformylase 2; hydrolase; HET: BB2 CIT; 1.70A {Bacillus cereus} PDB: 1lqy_A* Back     alignment and structure
>2os0_A Peptide deformylase; PDF, hydrolase; 1.30A {Enterococcus faecalis} PDB: 2os1_A* 3g6n_A 3cmd_A Back     alignment and structure
>1lm4_A Peptide deformylase PDF1; metalloenzyme, hydrolase; 1.45A {Staphylococcus aureus} SCOP: d.167.1.1 PDB: 1lqw_A 2ai9_A 1lmh_A 1q1y_A* Back     alignment and structure
>3svj_P Peptide deformylase 3; alpha-beta, metal binding protein, HYDR hydrolase inhibitor complex; HET: 4LI; 1.55A {Streptococcus pneumoniae} SCOP: d.167.1.1 PDB: 3str_P* 3sw8_P* 4eox_P* 1lm6_A 2aia_A* 2ai7_A* 2aie_P* 2os3_A* Back     alignment and structure
>3l87_A Peptide deformylase; hydrolase, iron, metal-binding, PR biosynthesis; 2.00A {Streptococcus mutans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d1v3ya_182 d.167.1.1 (A:) Peptide deformylase {Thermus thermo 6e-24
d1y6ha_177 d.167.1.1 (A:) Peptide deformylase {Leptospira int 1e-23
d1lm6a_202 d.167.1.1 (A:) Peptide deformylase {Streptococcus 3e-19
d1lmea_154 d.167.1.1 (A:) Peptide deformylase {Thermotoga mar 5e-18
d1lm4a_194 d.167.1.1 (A:) Peptide deformylase {Staphylococcus 6e-17
d1xeoa1164 d.167.1.1 (A:1-164) Peptide deformylase {Escherich 3e-16
d1rl4a_165 d.167.1.1 (A:) Peptide deformylase {Malaria parasi 3e-15
d1lqya_184 d.167.1.1 (A:) Peptide deformylase {Bacillus stear 2e-14
d1ix1a_169 d.167.1.1 (A:) Peptide deformylase {Pseudomonas ae 2e-14
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Thermus thermophilus [TaxId: 274]

 Score = 90.2 bits (223), Expect = 6e-24
 Identities = 35/136 (25%), Positives = 59/136 (43%), Gaps = 3/136 (2%)

Query: 2   KIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVW 61
           K +   M   M      GL+APQ+GL  RLF+           EG+ ++   +    +  
Sbjct: 27  KRLAEDMLETMFEAKGVGLAAPQIGLSQRLFVA---VEYADEPEGEEERPLRELVRRVYV 83

Query: 62  INPEMKILDYKDKVTALEGCASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARII 121
           +   +               +       +VPR  ++++   DE G+      EG+ AR+ 
Sbjct: 84  VANPVITYREGLVEGTEGCLSLPGLYSEEVPRAERIRVEYQDEEGRGRVLELEGYMARVF 143

Query: 122 QHEMDHLDGLLFTDSM 137
           QHE+DHLDG+LF + +
Sbjct: 144 QHEIDHLDGILFFERL 159
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Length = 177 Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Length = 202 Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Length = 154 Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Length = 194 Back     information, alignment and structure
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 184 Back     information, alignment and structure
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1y6ha_177 Peptide deformylase {Leptospira interrogans [TaxId 100.0
d1xeoa1164 Peptide deformylase {Escherichia coli [TaxId: 562] 100.0
d1ix1a_169 Peptide deformylase {Pseudomonas aeruginosa [TaxId 100.0
d1lmea_154 Peptide deformylase {Thermotoga maritima [TaxId: 2 100.0
d1rl4a_165 Peptide deformylase {Malaria parasite (Plasmodium 100.0
d1v3ya_182 Peptide deformylase {Thermus thermophilus [TaxId: 100.0
d1lqya_184 Peptide deformylase {Bacillus stearothermophilus [ 100.0
d1lm6a_202 Peptide deformylase {Streptococcus pneumoniae [Tax 100.0
d1lm4a_194 Peptide deformylase {Staphylococcus aureus [TaxId: 100.0
>d1y6ha_ d.167.1.1 (A:) Peptide deformylase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Peptide deformylase
superfamily: Peptide deformylase
family: Peptide deformylase
domain: Peptide deformylase
species: Leptospira interrogans [TaxId: 173]

Probab=100.00  E-value=3.1e-53  Score=332.27  Aligned_cols=143  Identities=27%  Similarity=0.399  Sum_probs=127.4

Q ss_pred             CHHHHHHHHHHHHhCCCeeEecccCCccceEEEEEcCCCCCCCcchhhhhhhcccCCcEEEEeceEEEecCceeeeCeeC
Q psy14392          1 MKIIILQMKNVMKRFDLFGLSAPQVGLPLRLFIVAFPDPEESFSEGDIKKFEMQAFPHMVWINPEMKILDYKDKVTALEG   80 (164)
Q Consensus         1 ~~~li~~m~~tm~~~~gvGLAApQIG~~~ri~vv~~~~~~~~~~~~~~~~~~~~~~~~~v~INP~I~~~s~e~~~~~~Eg   80 (164)
                      +++|+++|++||++++|+||||||||+++|+|||+.++.....        .....++.++|||+|+..|++ +..++||
T Consensus        30 ~~~li~dm~~tm~~~~GvGLAApQIGi~~ri~vi~~~~~~~~~--------~~~~~~~~v~iNP~I~~~s~~-~~~~~EG  100 (177)
T d1y6ha_          30 FKKLIRDMFDTMRHAEGVGLAAPQIGILKQIVVVGSEDNERYP--------GTPDVPERIILNPVITPLTKD-TSGFWEG  100 (177)
T ss_dssp             HHHHHHHHHHHHHHTTCSEEEGGGGTCCBSEEEECCSSCTTST--------TSCCCCCEEEEEEEEEECCSC-EEEEEEE
T ss_pred             HHHHHHHHHHHHHhcCccccchhhheeeeeEEEeecCcccccc--------cccccceeeecceEEEEeccc-eEEeecc
Confidence            3689999999999999999999999999999999886643111        112346789999999999998 9999999


Q ss_pred             CCCcCCCccccccCCeeEEEEECCCCCeEEEEEechhhhhHhhhhhhhCCeeeeeccCccccccchhhhhhh
Q psy14392         81 CASLKSLQAKVPRYRKVQLTGLDETGKPDSWTAEGWAARIIQHEMDHLDGLLFTDSMLPKSLECVCWQDINL  152 (164)
Q Consensus        81 CLS~pg~~~~V~R~~~I~v~y~d~~G~~~~~~~~g~~Ar~~QHEiDHL~G~l~~Dr~~~~~~~~~~~~~~~~  152 (164)
                      |||+||+++.|+||.+|+|+|+|++|++++.+++||.|||+|||+|||+|+||+||+++.++..+.-++.+.
T Consensus       101 CLS~Pg~~~~V~R~~~I~v~~~d~~G~~~~~~~~G~~Ar~iQHEiDHL~G~l~~Dr~~~~k~~~~~~~l~~~  172 (177)
T d1y6ha_         101 CLSVPGMRGYVERPNQIRMQWMDEKGNQFDETIDGYKAIVYQHECDHLQGILYVDRLKDTKLFGFNETLDSS  172 (177)
T ss_dssp             ETTEEEEEEEEEEESEEEEEEECTTCCEEEEEEEHHHHHHHHHHHHHHTTCCGGGGBSCTTSEEEHHHHHHH
T ss_pred             CcCcCCceeeeeeeeeeeeEecCCCCceeEEEechHHHHHHHHHHHHhCCEehhHhcChhhhHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999988877776666543
>d1xeoa1 d.167.1.1 (A:1-164) Peptide deformylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ix1a_ d.167.1.1 (A:) Peptide deformylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lmea_ d.167.1.1 (A:) Peptide deformylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rl4a_ d.167.1.1 (A:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1v3ya_ d.167.1.1 (A:) Peptide deformylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lm6a_ d.167.1.1 (A:) Peptide deformylase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1lm4a_ d.167.1.1 (A:) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure